Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0498 IGR0497 IGR0504 IGR0496 IGR0502.2 IGR0502 IGR0495 IGR0502.1 IGR0499 IGR0500 IGR0503 IGR0501 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 gcpE,ispG, - NG0594 merR, - NG0602 clpP, - NG0593 tig, - NG0592 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 gcpE,ispG, - NG0594 merR, - NG0602 clpP, - NG0593 tig, - NG0592 hip,ihfB, - NG0603 ndk, - NG0597 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 gcpE,ispG, - NG0594 NG0601 merR, - NG0602 clpP, - NG0593 tig, - NG0592
* Calculated from Protein Sequence

Gene ID: NG0597

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ndk  

Definition:
nucleoside diphosphate kinase protein

Gene Start:
584440

Gene Stop:
584141

Gene Length:
300

Molecular Weight*:
10912

pI*:
4.50

Net Charge*:
-6.52

EC:
2.7.4.6  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Sundin,G.W., Shankar,S., Chugani,S.A., Chopade,B.A., Kavanaugh-Black,A. and Chakrabarty,A.M. Nucleoside diphosphate kinase from Pseudomonas aeruginosa: characterization of the gene and its role in cellular growth and exopolysaccharide alginate synthesis. Mol. Microbiol. 20 (5): 965-979 (1996) [Medline: 96405621].

Munoz-Dorado,J., Inouye,M. and Inouye,S. Nucleoside diphosphate kinase from Myxococcus xanthus. I. Cloning and sequencing of the gene. J. Biol. Chem. 265 (5): 2702-2706 (1990) [Medline: 90153894].

Williams,R.L., Oren,D.A., Munoz-Dorado,J., Inouye,S., Inouye,M. and Arnold,E. Crystal structure of Myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 A resolution. J. Mol. Biol. 234 (4): 1230-1247 (1993) [Medline: 94087734].

Munoz-Dorado,J., Inouye,S. and Inouye,M. Nucleoside diphosphate kinase from Myxococcus xanthus. II. Biochemical characterization. J. Biol. Chem. 265 (5): 2707-2712 (1990) [Medline: 90153895].

Comment:
From GenBANK (gi:12230891): This protein has a major role in the synthesis of nucleoside triphosphates other than ATP. The reaction: ATP + nucleoside diphosphate = ADP + nucleoside triphosphate.

Oklahoma ID: NGO.597c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 1-100 are 67% similar to gb|AAF39590.1| (AE002346) nucleoside diphosphate kinase of Chlamydia muridarum.

Residues 1-100 are 99% similar to NMA1521, nucleoside diphosphate kinase of Neisseria meningitidis (11260901).


COGS Summary:  COGS Search
BeTs to 15 clades of COG0105
COG name: Nucleoside diphosphate kinase
Functional Class:  F
The phylogenetic pattern of COG0105 is amtkyq-cebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001564 (Nucleoside diphosphate kinase) with a combined E-value of 5e-43.
    IPB001564B    12-45
    IPB001564C    62-95


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0597 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 100 (E-value = 1.6e-37) place NG0597 in the NDK family which is described as Nucleoside diphosphate kinase (PF00334)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1NHK|1NHK-R NUCLEOSIDE DIPHOSPHATE KINASE (E.C.2.7.4.6) 141.0 3e-35
pdb|1NPK|1NPK NUCLEOSIDE DIPHOSPHATE KINASE (E.C.2.7.4.6) 98.7 2e-22
pdb|1B99|1B99-A 3'-FLUORO-URIDINE DIPHOSPHATE BINDING TO 98.7 2e-22
pdb|1HHQ|1HHQ-A ROLE

Gene Protein Sequence:
MKQLTLKEAQEFYAVHKDRPFYAGLVEFMTGGPVMIQVLEGENAVLKNRE
LMGATNPTEAAEGTIRADFATSVSINAVHGSDSVENAALEIAYFFSQTEI


Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCAGCTTACCCTCAAAGAAGCCCAAGAATTTTATGCGGTTCATAA
AGACCGCCCCTTCTATGCCGGATTGGTTGAATTTATGACCGGCGGTCCGG
TTATGATTCAAGTACTGGAAGGCGAAAACGCCGTTCTGAAAAACCGCGAA
CTGATGGGGGCGACCAATCCCACCGAAGCCGCAGAAGGCACGATACGCGC
GGACTTTGCCACTTCGGTCAGCATTAACGCCGTACACGGTTCCGACAGTG
TGGAAAATGCCGCTTTGGAAATTGCCTACTTTTTCAGCCAAACCGAAATC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy