Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0498 IGR0497 IGR0496 IGR0495 IGR0499 IGR0494 IGR0494.1 IGR0493 ndk, - NG0597 NG0591 pilF, - NG0595 NG0596 uraA,pyrP, - NG0589 gcpE,ispG, - NG0594 clpP, - NG0593 tig, - NG0592 ftsK,spoIIIE, - NG0590 ndk, - NG0597 NG0591 pilF, - NG0595 NG0596 uraA,pyrP, - NG0589 gcpE,ispG, - NG0594 clpP, - NG0593 tig, - NG0592 ftsK,spoIIIE, - NG0590 Type: inverse, Name:  - 167 ndk, - NG0597 NG0591 pilF, - NG0595 NG0596 uraA,pyrP, - NG0589 gcpE,ispG, - NG0594 clpP, - NG0593 tig, - NG0592 ftsK,spoIIIE, - NG0590
* Calculated from Protein Sequence

Gene ID: NG0592

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tig  

Definition:
trigger factor

Gene Start:
578769

Gene Stop:
580079

Gene Length:
1311

Molecular Weight*:
48357

pI*:
4.60

Net Charge*:
-19.45

EC:
5.2.1.8  

Functional Class:
Cellular processes; Chaperones  

Pathway: pathway table

Secondary Evidence:
Guthrie,B. and Wickner,W.
Trigger factor depletion or overproduction causes defective cell division but does not block protein export.
J. Bacteriol. 172 (10): 5555-5562 (1990)
Medline: 91008922.

Stoller,G., Tradler,T., Rucknagel,K.P., Rahfeld,J.-.U. and Fischer,G.
An 11.8 kDa proteolytic fragment of the E. coli trigger factor represents the domain carrying the peptidyl-prolyl cis/transisomerase activity.
FEBS Lett. 384 (2): 117-122 (1996)
Medline: 96201948.

Crooke,E., Guthrie,B., Lecker,S., Lill,R. and Wickner,W.
ProOmpA is stabilized for membrane translocation by either purified E. coli trigger factor or canine signal recognition particle.
Cell 54 (7): 1003-1011 (1988)
Medline: 88327844.

Valent,Q.A., Kendall,D.A., High,S., Kusters,R., Oudega,B. and Luirink,J.
Early events in preprotein recognition in E. coli: interaction of SRP and trigger factor with nascent polypeptides.
EMBO J. 14 (22): 5494-5505 (1995)
Medline: 96091121.

Blaha G, Wilson DN, Stoller G, Fischer G, Willumeit R, Nierhaus KH.
Localization of the Trigger Factor Binding Site on the Ribosomal 50S Subunit.
J Mol Biol. 2003 Feb;326(3):887-97.
PMID: 12581648

Maier R, Eckert B, Scholz C, Lilie H, Schmid FX.
Interaction of trigger factor with the ribosome.
J Mol Biol. 2003 Feb;326(2):585-92.
PMID: 12559924

Schiene-Fischer C, Habazettl J, Tradler T, Fischer G.
Evaluation of similarities in the cis/trans isomerase function of trigger factor and DnaK.
Biol Chem. 2002 Dec;383(12):1865-73.
PMID: 12553723

Patzelt H, Kramer G, Rauch T, Schönfeld HJ, Bukau B, Deuerling E.
Three-state equilibrium of Escherichia coli trigger factor.
Biol Chem. 2002 Oct;383(10):1611-9.
PMID: 12452438

Comment:
From GenBANK (gi:12230728): In N.meningitidis, this protein is involved in protein export. It acts as a chaperone by maintaining the newly synthesized protein in an open conformation.

From Medline (96091121): In Escherichia coli, components of a signal recognition particle (SRP) and its receptor have been identified which appear to be essential for efficient translocation of several proteins. E. coli SRP interacts with a variety of nascent presecretory proteins and integral inner membrane proteins.the interaction is correlated with the hydrophobicity of the core region of the signal sequence and thereby with its ability to promote transport in vivo. A second E. coli component, which is identified as trigger factor, can be efficiently cross-linked to all tested nascent chains derived from both secreted and cytosolic proteins. We propose that SRP and trigger factor act as secretion-specific and general molecular chaperone respectively, early in protein synthesis.


Oklahoma ID: NGO.592

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 2-433 are 41% similar to gb|AAG05189.1|AE004606_3 (AE004606) trigger factor of Pseudomonas aeruginosa.

Residues 1-437 are 96% similar to NMA1526 and NMB1313, both trigger factors of N.meningitidis (12230728, 12230727).


COGS Summary:  COGS Search
BeTs to 12 clades of COG0544
COG name: FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor)
Functional Class:  O
The phylogenetic pattern of COG0544 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001179 (FKBP-type peptidyl-prolyl cis-trans isomerase (PPIase)) with a combined E-value of 3.8e-08.
    IPB001179    191-224


ProDom Summary:  Protein Domain Search
Residues 237-424 are 23% similar to a (PROTEIN COILED COIL REPEAT FILAMENT HEPTAD PATTERN CHAIN) protein domain (PD000002) which is seen in O67358_AQUAE.

Residues 10-224 are 37% similar to a (TRIGGER FACTOR ISOMERASE TF) protein domain (PD005917) which is seen in TIG_HAEIN.

Residues 230-393 are 39% similar to a (TRIGGER FACTOR ISOMERASE TF) protein domain (PD186215) which is seen in TIG_ECOLI.



Paralogs:  Local Blast Search


NG0592 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 153 (E-value = 5.4e-58) place NG0592 in the Trigger_N family which is described as Bacterial trigger factor protein (TF) (PF05697)
Residues 154 to 240 (E-value = 1.2e-28) place NG0592 in the FKBP_C family which is described as FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254)
Residues 241 to 413 (E-value = 1.3e-51) place NG0592 in the Trigger_C family which is described as Bacterial trigger factor protein (TF) C-terminus (PF05698)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
61  
149
non-globular  
237  
354

PDB Hit:
pdb|1HXV|1HXV-A PPIASE DOMAIN OF THE MYCOPLASMA GENITALIUM 71.4 3e-13
pdb|1KT1|1KT1-A STRUCTURE OF THE LARGE FKBP-LIKE PROTEIN, 39.9 9e-04
pdb|1HXV|1HXV-A PPIASE DOMAIN OF THE MYCOPLASMA GENITALIUM 124.0 4e-29
pdb|1KT1|1KT1-A STRU

Gene Protein Sequence:
MMSVTVEILENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFRPGKA
PLKMIAQMYGASAQNDVINELVQRRFYDVAVAQELKVAGYPRFEGVEEQD
DKESFKVAAIFEVFPEVVIGDLSAQEVEKVTASVGDAEVDQTVEILRKQR
TRFNHVDREARNGDRVIIDFEGKIDGEPFAGGTSKNYAFVLGAGQMLPEF
EAGVVGMKAGESKDVTVNFPEEYHGKDVAGKTAVFTITLNNVSEPTLPEV
DADFAKALGIADGDVAKMREEVKKNVSREVERRVNEQTKESVMNALIKAV
ELKVPVALVNEEAARLANEMKQNFVNQGMTDAANLDLPLDMFKEQAERRV
SLGLILAKLVDENKLEPTEGQIKAVVANFAESYEDPQEVIDWYYADTSRL
QAPTSLAVESNVVDFVLGKAKVNKKALSFDEVMGAQA

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAGCGTAACTGTTGAAATTTTAGAAAATCTGGAACGCAAAGTAGT
GTTGTCCCTGCCTTGGTCCGAAATCAACGCAGAAACCGATAAAAAACTGA
AACAAACCCAACGCCGTGCAAAAATCGACGGTTTCCGTCCGGGTAAAGCA
CCTTTAAAAATGATTGCCCAAATGTACGGTGCGAGCGCGCAAAACGACGT
GATCAACGAGCTGGTGCAACGCCGCTTCTACGATGTTGCCGTTGCCCAAG
AGTTGAAAGTGGCAGGCTATCCACGTTTTGAAGGCGTTGAAGAACAAGAC
GATAAAGAGTCTTTCAAAGTTGCCGCCATTTTTGAAGTGTTCCCCGAAGT
CGTTATCGGCGATTTGTCTGCACAAGAGGTCGAAAAAGTAACCGCTTCCG
TCGGCGATGCCGAAGTCGACCAAACTGTAGAAATCCTGCGTAAACAACGT
ACCCGCTTCAACCATGTTGACCGCGAAGCCCGAAACGGCGACCGCGTCAT
CATCGACTTTGAAGGCAAAATCGACGGCGAACCTTTTGCCGGCGGCACAT
CCAAAAACTACGCCTTCGTATTGGGCGCAGGTCAAATGCTGCCTGAATTT
GAAGCCGGCGTAGTCGGCATGAAAGCGGGCGAAAGTAAAGACGTTACCGT
CAACTTCCCTGAAGAATACCACGGCAAAGATGTTGCCGGTAAAACTGCCG
TGTTCACCATTACGCTGAACAATGTTTCCGAGCCCACTCTGCCTGAAGTC
GATGCAGATTTTGCAAAAGCCTTGGGTATTGCGGATGGCGATGTTGCCAA
AATGCGTGAAGAAGTGAAGAAAAACGTAAGCCGCGAAGTGGAACGCCGCG
TGAACGAACAAACCAAAGAATCCGTAATGAACGCGCTGATTAAAGCCGTA
GAGTTGAAAGTTCCGGTTGCTTTGGTCAATGAAGAAGCCGCCCGCCTGGC
AAACGAAATGAAACAAAACTTCGTTAACCAAGGTATGACCGATGCCGCGA
ACTTGGATTTGCCTTTGGATATGTTCAAAGAACAAGCCGAACGTCGCGTA
TCTTTGGGTCTGATTTTGGCCAAACTGGTTGACGAAAACAAACTGGAACC
GACTGAAGGGCAAATCAAAGCCGTTGTCGCCAACTTCGCAGAAAGCTACG
AAGATCCTCAAGAAGTGATTGACTGGTACTACGCAGATACTTCCCGCCTG
CAAGCCCCGACTTCTTTGGCAGTAGAAAGCAACGTTGTTGATTTCGTTTT
GGGCAAAGCCAAAGTAAACAAAAAAGCTTTGTCTTTTGACGAAGTGATGG
GCGCGCAAGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy