Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0489 IGR0485 IGR0486 IGR0487 IGR0492 IGR0490 IGR0491 IGR0483 IGR0484 IGR0493 IGR0488 NG0587 pss, - NG0586 NG0585 uraA,pyrP, - NG0589 copA, - NG0579 rpsR, - NG0583 NG0582 rpsF, - NG0581 rplI, - NG0584 NG0588 trxB, - NG0580 ftsK,spoIIIE, - NG0590 NG0587 pss, - NG0586 NG0585 uraA,pyrP, - NG0589 copA, - NG0579 rpsR, - NG0583 NG0582 rpsF, - NG0581 rplI, - NG0584 NG0588 trxB, - NG0580 ftsK,spoIIIE, - NG0590 NG0587 pss, - NG0586 NG0585 uraA,pyrP, - NG0589 copA, - NG0579 rpsF, - NG0581 rplI, - NG0584 NG0588 trxB, - NG0580 ftsK,spoIIIE, - NG0590 NG0582 rpsR, - NG0583
* Calculated from Protein Sequence

Gene ID: NG0586

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pss  

Definition:
phosphatidylserine synthase

Gene Start:
572913

Gene Stop:
572170

Gene Length:
744

Molecular Weight*:
27897

pI*:
10.60

Net Charge*:
9.61

EC:
2.7.8.8  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Glycine, serine and threonine metabolism

Secondary Evidence:

Okada,M., Matsuzaki,H., Shibuya,I. and Matsumoto,K.
Cloning, sequencing, and expression in Escherichia coli of the Bacillus subtilis gene for phosphatidylserine synthase.
J. Bacteriol. 176 (24): 7456-7461 (1994)
Medline: 95095912.

Salamon Z, Lindblom G, Rilfors L, Linde K, Tollin G.
Interaction of phosphatidylserine synthase from E. coli with lipid bilayers: coupled plasmon-waveguide resonance spectroscopy studies.
Biophys J. 2000 Mar;78(3):1400-12.
PMID: 10692325

Oshiro J, Rangaswamy S, Chen X, Han GS, Quinn JE, Carman GM.
Regulation of the DPP1-encoded diacylglycerol pyrophosphate (DGPP) phosphatase by inositol and growth phase. Inhibition of DGPP phosphatase activity by CDP-diacylglyceron and activation of phosphatidylserine synthase activity by DGPP.
J Biol Chem. 2000 Dec;275(52):40887-96.
PMID: 11016943

Comment:
From GenBANK (gi:131441): Reaction: CDP-diacylglycerol + l-serine = CMP + O-SN-phosphatidyl-L-serine, the committed step in the synthesis of phosphatidylcholine (bremer-greenberg pathway). This protein is located in the microsomal and outer mitochondrial membranes and is membrane-bound.

Oklahoma ID: NGO.586c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phosphatidylserine synthases; e.g. residues 10-239 are 52% similar to gb|AAG08079.1|AE004883_3 (AE004883) phosphatidylserine synthase of Pseudomonas aeruginosa.

Residues 1-248 is 100% similar to NMA1532 and AE002480, both phosphatidylserine synthases in N.meningitidis (11262017, 7226560).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1183
COG name: Phosphatidylserine synthase
Functional Class:  I
The phylogenetic pattern of COG1183 is amt-y----br-uj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000462 (CDP-alcohol phosphatidyltransferase) with a combined E-value of 1.1e-16.
    IPB000462    58-94


ProDom Summary:  Protein Domain Search
Residues 51-126 are 55% similar to a (TRANSFERASE SYNTHASE PROTEIN 3-PHOSPHATIDYLTRANSFERASE) protein domain (PD001399) which is seen in PSS_HELPY.



Paralogs:  Local Blast Search


NG0586 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 48 to 195 (E-value = 2.3e-24) place NG0586 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
109  
125
transmembrane  
137  
153
transmembrane  
170  
186
transmembrane  
198  
214
transmembrane  
219  
235

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
METPTNTPQRSLRQNSIYLLPNSFTIAALFSAFYAITQSMHGRYETAAIA
VFISMLLDGMDGRVARLTNSQSAFGEQLDSLADMVSFGVAPALIAYKWQL
WQFGKIGYSVAFIYCACAALRLALFNTLIGKVDKRWFIGVPSPTAAALIV
GLIWVNHSVEKFPAVHWWALGITLFAGLSMIVQIPFWSFKEINIRRQVPF
VGMLLAVLLLLLVTWEPSLVLFLFFLGYSLSGYIMAARRFWKKYRKAD

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAACCCCGACCAACACCCCGCAACGCTCCCTGCGTCAAAACAGTAT
CTACCTGCTGCCCAATTCCTTTACCATCGCCGCGCTGTTTTCCGCATTTT
ACGCAATCACCCAATCCATGCACGGACGTTATGAAACCGCCGCCATCGCG
GTATTCATCTCTATGTTGCTGGACGGTATGGACGGGCGCGTGGCGCGGCT
GACCAACAGCCAAAGCGCGTTCGGGGAGCAGCTCGACAGCCTTGCCGACA
TGGTCAGCTTCGGCGTTGCCCCCGCGCTTATTGCCTACAAATGGCAGCTT
TGGCAGTTCGGCAAAATCGGTTATTCCGTCGCCTTCATCTACTGCGCCTG
CGCCGCCCTACGCCTCGCGCTGTTCAACACGCTCATCGGCAAGGTGGACA
AACGCTGGTTTATCGGCGTACCCAGTCCGACTGCCGCCGCGCTGATTGTC
GGGCTGATTTGGGTCAACCACAGCGTCGAAAAATTCCCCGCCGTCCACTG
GTGGGCATTAGGCATCACACTGTTTGCCGGCCTGTCGATGATTGTCCAAA
TCCCTTTTTGGAGTTTTAAAGAAATCAACATCCGCAGACAAGTCCCCTTT
GTCGGAATGCTGCTTGCCGTCTTACTGCTGCTTCTGGTCACTTGGGAACC
GTCGCTCGTCCTTTTCCTGTTCTTTCTCGGATACAGCCTGTCCGGCTACA
TTATGGCGGCACGCCGATTTTGGAAAAAATACAGAAAGGCGGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy