Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0485 IGR0486 IGR0480 IGR0487 IGR0482 IGR0481 IGR0483 IGR0479 IGR0484 IGR0488 NG0577 NG0575 NG0585 NG0576 uvrC, - NG0578 copA, - NG0579 rpsR, - NG0583 NG0582 rpsF, - NG0581 rplI, - NG0584 trxB, - NG0580 NG0577 NG0575 NG0585 NG0576 uvrC, - NG0578 copA, - NG0579 rpsR, - NG0583 NG0582 rpsF, - NG0581 rplI, - NG0584 trxB, - NG0580 NG0577 NG0575 NG0585 NG0576 uvrC, - NG0578 copA, - NG0579 rpsF, - NG0581 rplI, - NG0584 trxB, - NG0580 NG0582 rpsR, - NG0583
* Calculated from Protein Sequence

Gene ID: NG0579

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
copA  

Definition:
cation transport ATPase protein

Gene Start:
568115

Gene Stop:
565941

Gene Length:
2175

Molecular Weight*:
76982

pI*:
6.60

Net Charge*:
-4.10

EC:
3.6.1.-  

Functional Class:
Transport and binding proteins; Cations  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Odermatt,A., Suter,H., Krapf,R. and Solioz,M.
Primary structure of two P-type ATPases involved in copper homeostasis in Enterococcus hirae.
J. Biol. Chem. 268 (17): 12775-12779 (1993)
Medline: 93286122.

Odermatt,A. and Solioz,M.
Two trans-acting metalloregulatory proteins controlling expression of the copper-ATPases of Enterococcus hirae.
J. Biol. Chem. 270 (9): 4349-4354 (1995)
Medline: 95181419.

Bayle,D., Wangler,S., Weitzenegger,T., Steinhilber,W., Volz,J.,Przybylski,M., Schafer,K.P., Sachs,G. and Melchers,K. Properties of the P-type ATPases encoded by the copAP operons of Helicobacter pylori and Helicobacter felis.
J. Bacteriol. 180 (2): 317-329 (1998)
Medline: 9810147.

Comment:
From GenBANK (gi:416665): CopA of Enterococcus hirae is a copper transporting protein, and along with copb, is implicated in the regulation of cytoplasmic copper, CopA being the importer and CopB the exporter of the metal. They may serve for the import of other metals. Catalytic activity: ATP + H2O + Cu2+ (in) = ADP + phosphate + Cu(2+)(out). It is an integral membrane protein that is induced by copper.

Oklahoma ID: NGO.579c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to metal and cation transport ATPases; e.g. residues 3-are 66% similar to gb|AAC21955.1| (U32715) potassium/copper-transporting ATPase, putative of Haemophilus influenzae Rd.

Residues 1-725 are 94% similar to NMB1325 and NMA1539, cation transport ATPases of N.meningitidis (11267405, 11267401).


COGS Summary:  COGS Search
BeTs to 12 clades of COG2217
COG name: Cation transport ATPases
Functional Class:  P
The phylogenetic pattern of COG2217 is AmT-YQvCEBRhUJ---lin-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001757 (E1-E2 ATPases) with a combined E-value of 1.7e-19.
    IPB001757A    421-432
    IPB001757B    608-637
***** IPB001934 (Heavy-metal-associated domain) with a combined E-value of 2.9e-15.
    IPB001934A    9-31
    IPB001934B    420-430


ProDom Summary:  Protein Domain Search
Residues 4-66 are 68% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000309) which is seen in Y290_HAEIN.

Residues 465-632 are 25% similar to a (ATPASE PROBABLE COPPER-TRANSPORTING) protein domain (PD037883) which is seen in ATU1_YEAST.

Residues 448-578 are 32% similar to a (PROBABLE COPPER-TRANSPORTING ATPASE SYNA) protein domain (PD169626) which is seen in ATSY_SYNP7.

Residues 347-432 are 55% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000466) which is seen in Y290_HAEIN.

Residues 294-341 are 79% similar to a (ATPASE HYDROLASE TRANSMEMBRANE) protein domain (PD000764) which is seen in Y290_HAEIN.

Residues 87-205 are 68% similar to a (ATPASE HYDROLASE TRANSMEMBRANE) protein domain (PD001539) which is seen in Y290_HAEIN.

Residues 571-635 are 72% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000121) which is seen in Y290_HAEIN.

Residues 636-720 are 65% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000140) which is seen in Y290_HAEIN.

Residues 206-288 are 55% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000132) which is seen in Y290_HAEIN.

Residues 516-570 are 58% similar to a (PROBABLE CATION-TRANSPORTING ATPASE) protein domain (PD114310) which is seen in Y290_HAEIN.

Residues 447-513 are 53% similar to a (ATPASE HYDROLASE TRANSMEMBRANE) protein domain (PD037880) which is seen in Y290_HAEIN.

Residues 225-584 are 21% similar to a (L2385.6 PROTEIN) protein domain (PD217475) which is seen in O97198_LEIMA.



Paralogs:  Local Blast Search


NG0579 is paralogously related to NG0685 (cation transport ATPase, E1-E2 family) (3e-95).


Pfam Summary:  Pfam Search
Residues 6 to 70 (E-value = 3.6e-17) place NG0579 in the HMA family which is described as Heavy-metal-associated domain (PF00403)
Residues 194 to 414 (E-value = 2.3e-74) place NG0579 in the E1-E2_ATPase family which is described as E1-E2 ATPase (PF00122)
Residues 418 to 640 (E-value = 6.6e-32) place NG0579 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
91  
107
transmembrane  
122  
138
transmembrane  
157  
173
transmembrane  
189  
205
non-globular  
255  
725
transmembrane  
341  
357
transmembrane  
367  
383
transmembrane  
677  
693
transmembrane  
698  
714

PDB Hit:
pdb|1MHS|1MHS-A MODEL OF NEUROSPORA CRASSA PROTON ATPASE 103.0 1e-22
pdb|1KQK|1KQK-A SOLUTION STRUCTURE OF THE N-TERMINAL DOMAIN OF 71.4 5e-13
pdb|1JWW|1JWW-A NMR CHARACTERIZATION OF THE N-TERMINAL DOMAIN 69.9 1e-12
pdb|1EUL|1EUL-A CRYS

Gene Protein Sequence:
MQQKIRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFASEEAQVTFDGS
KTSVADIAKIIEKTGYGAKEKTEDTLPQPEAEHHIGWRLWLLLTINIPFL
IGMVGMMLKGLNWTRHDWMIPPVWQFVLASIVQLWLAIPFYKSAWASIKG
GLANMDVLVTIGTVSIYLYSVYMLFFSSHAAHGMAHVYFEAGVMVIGFVS
LGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRNGEWKQLPIDQVQIGDLI
RTNHGERIAADGIIESGSGWADESHLTGESNPEEKKAGGKVLAGALMTEG
SVVYRAAQLGSQTLLGDMMNALSEAQGSKAPIARVADKAAAVFVPTVVGI
ALLTFIVAWLIKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGMGKAV
KHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQVAAVYYVPDSGFDED
ALYRIAAAVEQNAAHPLARAIVSAAQARGLEIPAAQNAQTVVGAGITAEV
EGVGLVKSGKAEFAELTLPKFSDGVWEIASAVTVSVNGKPIGAFALSDAL
KADTAEAIGRLKKHNIDVYIMSGDNQSTVEYVAKQLGIAHAFGNMSPCDK
AAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGADVAEHTASAT
LMQHSVNQLADALLISQATLENIKQNLFFAFFYNILGIPLAALGFLNPVI
AGAAMAASSVSVLGNALRLKWVKID

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACAAAAAATCCGTTTCCAAATCGAGGGGATGACCTGTCAGGCATG
TGCTTCGCGCATTGAAAAAGTGTTGAACAAAAAAGATTTTGTCGAATCGG
CGGGAGTGAACTTTGCCAGTGAGGAAGCGCAGGTTACGTTTGACGGCAGC
AAAACCTCGGTTGCCGACATTGCCAAAATCATTGAGAAAACCGGTTACGG
CGCGAAGGAAAAAACGGAAGATACATTGCCGCAACCTGAAGCAGAACACC
ATATCGGCTGGCGGTTGTGGCTTTTGCTGACCATCAATATCCCGTTCCTT
ATCGGTATGGTAGGGATGATGCTAAAAGGGCTGAATTGGACACGGCACGA
TTGGATGATTCCGCCTGTATGGCAGTTTGTACTGGCAAGCATAGTGCAAC
TTTGGCTGGCAATCCCGTTTTACAAAAGCGCGTGGGCAAGCATTAAAGGC
GGGCTGGCGAATATGGACGTACTCGTTACCATCGGCACGGTGTCGATTTA
CCTGTATTCCGTTTATATGCTGTTTTTCAGTTCGCATGCGGCGCACGGTA
TGGCGCATGTGTATTTTGAAGCGGGCGTGATGGTGATCGGTTTTGTGTCG
CTGGGTAAGTTTTTGGAACACCGCACCAAAAAATCCAGCCTGAACAGCTT
GGGCTTACTGCTAAAACTCACGCCGACCCAAGTCAACGTGCAACGCAACG
GCGAATGGAAACAACTGCCCATCGACCAAGTGCAAATCGGCGACCTTATC
CGCACCAACCACGGCGAACGCATCGCTGCCGACGGCATTATCGAAAGCGG
CAGCGGTTGGGCGGACGAAAGCCACCTTACCGGCGAATCCAATCCCGAAG
AGAAAAAGGCGGGCGGCAAAGTGTTGGCGGGCGCGCTGATGACCGAAGGC
AGCGTGGTGTACCGCGCCGCGCAGCTCGGCAGCCAAACCCTGCTCGGCGA
CATGATGAACGCGCTCTCTGAAGCACAAGGCAGTAAAGCACCGATTGCGC
GCGTGGCCGATAAAGCGGCGGCGGTATTTGTGCCAACTGTCGTGGGCATC
GCGCTTCTGACTTTTATCGTTGCTTGGCTGATTAAGGGCGATTGGACGGT
CGCACTGATGCACGCCGTTGCCGTTTTGGTGATTGCCTGCCCGTGCGCGC
TCGGTCTGGCGACCCCTGCCGCGATTATGGTCGGCATGGGCAAAGCGGTG
AAACACGGCATTTGGTTTAAAGACGCGGCGGCAATGGAGGAAGCAGCCCA
CGTCGATGCCGTCGTATTGGACAAAACCGGTACGCTGACCGAAGGCAGGC
CGCAGGTTGCCGCCGTTTATTACGTTCCCGACAGCGGCTTTGACGAAGAC
GCTTTGTACCGCATCGCCGCCGCCGTCGAGCAAAACGCCGCCCACCCGCT
CGCCCGCGCCATCGTCTCCGCCGCACAAGCGCGCGGTTTGGAGATTCCCG
CTGCACAAAATGCGCAAACCGTTGTCGGAGCAGGCATTACCGCCGAAGTG
GAAGGCGTGGGTTTGGTGAAATCAGGCAAAGCCGAATTTGCCGAACTGAC
CTTGCCGAAGTTTTCAGACGGCGTTTGGGAAATCGCCAGTGCGGTTACCG
TATCTGTAAACGGCAAACCGATCGGCGCATTCGCACTCTCCGACGCGTTG
AAAGCCGATACCGCCGAAGCCATAGGCCGTCTGAAAAAACACAATATCGA
TGTCTATATTATGAGCGGCGATAACCAAAGTACGGTCGAATACGTCGCCA
AACAACTGGGCATCGCACACGCCTTCGGTAATATGAGTCCGTGCGACAAA
GCCGCCGAAGTGCAGAAACTCAAAGCCGCCGGCAAAACCGTGGCGATGGT
CGGCGACGGCATCAACGACGCGCCCGCGCTTGCCGCCGCCAACGTCAGCT
TCGCCATGAAAGGCGGTGCGGACGTTGCCGAACACACCGCCTCCGCCACG
CTGATGCAGCATTCGGTCAATCAGCTCGCCGATGCCCTGCTGATATCGCA
GGCAACGTTGGAAAACATCAAGCAAAACCTATTTTTCGCCTTCTTCTACA
ATATATTGGGCATTCCGCTCGCCGCGCTCGGCTTTTTAAATCCCGTCATA
GCAGGCGCGGCAATGGCGGCAAGCTCGGTTTCGGTATTGGGCAATGCCCT
GCGCCTGAAATGGGTAAAAATCGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy