Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0480 IGR0482 IGR0481 IGR0479 IGR0477 IGR0476 IGR0478 NG0577 NG0575 cyn,cah, - NG0574 NG0576 uvrC, - NG0578 copA, - NG0579 ctpA, - NG0572 uvrB, - NG0573 NG0577 NG0575 cyn,cah, - NG0574 NG0576 uvrC, - NG0578 copA, - NG0579 ctpA, - NG0572 uvrB, - NG0573 NG0577 NG0575 cyn,cah, - NG0574 NG0576 uvrC, - NG0578 copA, - NG0579 ctpA, - NG0572 uvrB, - NG0573
* Calculated from Protein Sequence

Gene ID: NG0575

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible methyltransferase) (possible DNA mismatch repair protein MicA)

Gene Start:
562353

Gene Stop:
561640

Gene Length:
714

Molecular Weight*:
26947

pI*:
6.90

Net Charge*:
-0.35

EC:
2.1.1.-  

Functional Class:
Unknown  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Tsai-Wu,J.-J., Radicella,J.P. and Lu,A.-L.
Nucleotide sequence of the Escherichia coli micA gene required for A/G-specific mismatch repair: Identity of MicA and MutY. J. Bacteriol. 173, 1902-1910 (1991)
Medline: 91161503.

Comment:
Oklahoma ID: NGO.575c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to hypothetical methyltransferases and DNA mismatch repair proteins; e.g. residues 19-237 are 52% similar to gb|AAC75997.1| (AE000378) orf, hypothetical protein of Escherichia coli K12, residues 19-237 are 49% similar to AE004476, DNA mismatch repair protein MicA, of Pseudomonas aeruginosa.

Residues 1-238 are 95% similar to NMB1328 and are 94% similar to NMA1542, both hypothetical methyltransferases of N.meningitidis (14194938, 14194937).


COGS Summary:  COGS Search
BeTs to 12 clades of COG0220
COG name: Predicted S-adenosylmethionine-dependent methyltransferase
Functional Class:  R
The phylogenetic pattern of COG0220 is ----yqvcebrhujgp-linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003358 (Putative methyltransferase) with a combined E-value of 2.2e-51.
    IPB003358A    69-95
    IPB003358B    135-153
    IPB003358C    154-193


ProDom Summary:  Protein Domain Search
Residues 56-234 are 55% similar to a (PROTEIN METHYLTRANSFERASE HOMOLOG) protein domain (PD005334) which is seen in YGGH_ECOLI.



Paralogs:  Local Blast Search


NG0575 is paralogously related to NG0538 (hypothetical protein) (2e-04).


Pfam Summary:  Pfam Search
Residues 43 to 237 (E-value = 1.8e-72) place NG0575 in the Methyltransf_4 family which is described as Putative methyltransferase (PF02390)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTDTPENQTPNDLPAGHSRSIRSFVLRQSHMTAAQQRAIDTLWDSFGIDY
QATPADLDARFGSSRPKILEIGFGMGMASAEIARRLPETDFLAIDVHGPG
VGNLLKLINENHLENIRVMRHDAVEVVENMLQDGSLDGIHIFFPDPWHKK
RHHKRRLIQAPFIAKLLPKLKTGGYIHLATDWEEYAQQMLEVLSSFDNLQ
NTAADYAPTPDYRPETKFEARGKRLGHGVWDLVFKRIG

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGACACCCCCGAAAACCAAACACCAAACGACCTGCCGGCCGGACA
CTCCCGCAGCATCCGCAGTTTCGTCCTCCGCCAAAGCCACATGACCGCCG
CACAGCAACGCGCCATCGATACCTTATGGGACAGCTTCGGCATCGACTAC
CAAGCAACACCGGCCGATCTTGATGCCCGTTTCGGAAGCAGCCGACCTAA
AATCCTCGAAATAGGCTTCGGTATGGGAATGGCAAGCGCAGAAATCGCCC
GCCGCCTGCCCGAAACCGACTTTCTCGCCATCGACGTACACGGCCCCGGC
GTAGGCAACCTGCTCAAACTCATCAACGAAAACCATTTGGAAAACATCCG
CGTGATGCGGCACGATGCCGTAGAAGTTGTCGAAAATATGCTGCAAGACG
GCTCGCTCGACGGCATCCACATATTCTTCCCCGACCCGTGGCACAAAAAA
CGCCACCACAAACGCCGTCTGATACAAGCCCCCTTCATCGCCAAACTACT
GCCCAAACTCAAAACCGGCGGCTATATCCACCTGGCGACAGACTGGGAAG
AATATGCACAGCAGATGCTTGAAGTCCTCAGCAGCTTCGACAACCTGCAA
AATACGGCGGCAGACTACGCCCCCACTCCGGACTACCGCCCCGAAACCAA
ATTCGAAGCGCGCGGCAAACGCCTCGGACACGGCGTTTGGGACTTGGTAT
TCAAACGGATCGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy