Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0480 IGR0481 IGR0475 IGR0479 IGR0477 IGR0476 IGR0478 NG0577 NG0575 cyn,cah, - NG0574 NG0576 uvrC, - NG0578 ctpA, - NG0572 NG0571 uvrB, - NG0573 NG0577 NG0575 cyn,cah, - NG0574 NG0576 uvrC, - NG0578 ctpA, - NG0572 NG0571 uvrB, - NG0573 NG0577 NG0575 cyn,cah, - NG0574 NG0576 uvrC, - NG0578 ctpA, - NG0572 NG0571 uvrB, - NG0573
* Calculated from Protein Sequence

Gene ID: NG0574

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cyn  cah  

Definition:
carbonic anhydrase (carbonate dehydratase)

Gene Start:
560557

Gene Stop:
559802

Gene Length:
756

Molecular Weight*:
28071

pI*:
9.90

Net Charge*:
8.26

EC:
4.2.1.1  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Nitrogen metabolism

Primary Evidence:
Chirica,L.C., Elleby,B., Jonsson,B.H. and Lindskog,S.,
The complete sequence, expression in Escherichia coli, purification and some properties of carbonic anhydrase from Neisseria gonorrhoeae,
Eur. J. Biochem. 244 (3), 755-760 (1997).
Medline: 97261830.

Huang,S., Xue,Y., Sauer-Eriksson,E., Chirica,L., Lindskog,S. and Jonsson,B.H.
Crystal structure of carbonic anhydrase from Neisseria gonorrhoeae and its complex with the inhibitor acetazolamide.
J. Mol. Biol. 283 (1): 301-310 (1998)
Medline: 98437389.

Secondary Evidence:
Fernley,R.T., Wright,R.D. and Coghlan,J.P.,
Complete amino acid sequence of ovine salivary carbonic anhydrase, Biochemistry 27 (8), 2815-2820 (1988).
Medline: 88294021.

Soltes-Rak,E., Mulligan,M.E. and Coleman,J.R.
Identification and characterization of a gene encoding a vertebrate-type carbonic anhydrase in cyanobacteria.
J. Bacteriol. 179 (3): 769-774 (1997)
Medline: 97158672.

Mitsuhashi,S. and Miyachi,S.
Amino acid sequence homology between N- and C-terminal halves of a carbonic anhydrase in Porphyridium purpureum, as deduced from the cloned cDNA
J. Biol. Chem. 271 (45), 28703-28709 (1996)
Medline: 97067104

Sung,Y.-C. and Fuchs,J.A.
Characterization of the cyn operon in Escherichia coli K12
J. Biol. Chem. 263, 14769-14775 (1988)
Medline: 89008347

Comment:
From GenBANK (gi:5915870): The function of carbonic anhydrase is the reversible hydration of carbon dioxide, requiring Zinc as a co-factor. Reaction: H2CO3 = CO2 + H2O.

Oklahoma ID: NGO.574c

Blast Summary:  PSI-Blast Search
NG0574 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1841441, a predicted carbonic anhydrase. See also 4139722, 4139723, 4389447, 555750.

Numerous significant hits in gapped BLAST to carbonic anhydrases; e.g. residues 13-251 are 43% similar to gb|AAC77891.1| (AF040381) carbonic anhydrase of Pectobacterium carotovorum.

No hits in gapped BLAST to N. meningitidis.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB001148 (Eukaryotic-type carbonic anhydrase) with a combined E-value of 4.2e-51.
    IPB001148A    55-65
    IPB001148B    86-101
    IPB001148C    110-142
    IPB001148D    144-168
    IPB001148E    195-213
    IPB001148F    238-250


ProDom Summary:  Protein Domain Search
Residues 1-32 are identical to a (CARBONIC ANHYDRASE PRECURSOR EC) protein domain (PD010880) which is seen in CAH_NEIGO.

Residues 33-250 are identical to a (CARBONIC ANHYDRASE DEHYDRATASE LYASE) protein domain (PD000865) which is seen in CAH_NEIGO.


Paralogs:  Local Blast Search


NG0574 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 33 to 251 (E-value = 3.1e-22) place NG0574 in the Carb_anhydrase family which is described as Eukaryotic-type carbonic anhydrase (PF00194)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26
cleavable N-terminal sequence  
1  
28

PDB Hit:
pdb|1KOP|1KOP-A NEISSERIA GONORRHOEAE CARBONIC ANHYDRASE 471.0 0e+00
pdb|1KOQ|1KOQ-A NEISSERIA GONORRHOEAE CARBONIC ANHYDRASE 450.0 0e+00
pdb|1J9W|1J9W-A SOLUTION STRUCTURE OF THE CAI MICHIGAN 1 VARIANT111.0 1e-25
pdb|1AZM|1AZM DRUG-

Gene Protein Sequence:
MPRFPRTLPRLTAVLLLACTAFSAAAHGNHTHWGYTGHDSPESWGNLSEE
FRLCSTGKNQSPVNITETVSGKLPAIKVNYKPSMVDVENNGHTIQVNYPE
GGNTLTVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQPLVL
AVLYEAGKTNGRLSSIWNVMPMTAGKVKLNQPFDASTLLPKRLKYYRFAG
SLTTPPCTEGVSWLVLKTYDHIDQAQAEKFTRAVGSENNRPVQPLNARVV
IE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTCGTTTCCCCCGCACTTTACCCCGCCTGACCGCTGTCCTGCTGTT
GGCCTGTACCGCTTTCTCCGCCGCCGCACACGGCAATCACACCCATTGGG
GCTATACCGGACACGACTCTCCCGAAAGCTGGGGCAATCTGTCAGAAGAA
TTCCGTTTGTGCTCCACCGGCAAAAACCAATCTCCGGTAAACATTACCGA
AACCGTTTCCGGCAAACTGCCCGCCATCAAAGTCAATTACAAACCGAGTA
TGGTTGACGTGGAAAACAACGGCCACACCATTCAGGTCAATTATCCCGAA
GGCGGCAATACCCTGACCGTGAACGGCCGCACCTATACCCTGAAACAGTT
CCACTTCCACGTGCCGAGCGAAAACCAAATCAAAGGCCGCACTTTCCCGA
TGGAAGCTCACTTCGTCCACTTAGACGAAAACAAACAGCCTTTAGTATTA
GCCGTGCTGTATGAAGCCGGCAAAACCAACGGCCGCCTGTCTTCCATCTG
GAACGTCATGCCGATGACCGCAGGAAAAGTGAAACTCAACCAACCGTTCG
ACGCATCCACCCTACTGCCGAAACGGTTGAAATACTACCGCTTTGCCGGT
TCGCTGACCACGCCGCCGTGCACAGAGGGCGTATCATGGTTGGTGTTGAA
AACTTATGACCACATCGACCAAGCGCAAGCGGAAAAATTCACCCGCGCCG
TCGGTTCGGAAAACAACCGCCCCGTACAGCCTCTGAATGCACGTGTAGTT
ATTGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy