Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0473 IGR0472 IGR0471 IGR0469 IGR0474 IGR0470 NG0569 creA,rob, - NG0570 aceF, - NG0564 aceE, - NG0565 NG0567 drpA,proS, - NG0566 NG0571 NG0569 creA,rob, - NG0570 aceF, - NG0564 aceE, - NG0565 NG0567 drpA,proS, - NG0566 NG0571 Type: tandem, Name:  - 29 Type: tandem, Name:  - 30 creA,rob, - NG0570 aceF, - NG0564 aceE, - NG0565 NG0568 NG0569 NG0568 NG0567 drpA,proS, - NG0566 NG0571
* Calculated from Protein Sequence

Gene ID: NG0566

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
drpA  proS  

Definition:
prolyl-tRNA synthetase protein

Gene Start:
549541

Gene Stop:
551250

Gene Length:
1710

Molecular Weight*:
62859

pI*:
5.10

Net Charge*:
-16.46

EC:
6.1.1.15  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Arginine and proline metabolism

Secondary Evidence:
Eriani,G., Delarue,M., Poch,O., Gangloff,J. and Moras,D. Partition of tRNA synthetases into two classes based on mutually exclusive sets of sequence motifs.
Nature 347 (6289): 203-206 (1990)
Medline: 90370122.

Zhou,Z. and Syvanen,M.
Identification and sequence of the drpA gene from Escherichia coli.
J. Bacteriol. 172 (1): 281-286 (1990)
Medline: 90094229.

Comment:
For other 'pro' genes see NG1905 (proC) and NG0850 (proA).



From GenBANK (gi:586061): Catalytic activity of this protein: ATP + L-proline + tRNA(pro) = AMP + pyrophosphate + L-prolyl-tRNA(pro).

Oklahoma ID: NGO.566

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 1-559 are 60% similar to gb|AAG04345.1|AE004529_11 (AE004529) prolyl-tRNA synthetase of Pseudomonas aeruginosa.

Residues 1-570 are 97% similar to NMA1553 and 96% similar to NMB1339, both prolyl-tRNA synthetases of Neisseria meningitidis (11271602, 11271606).


COGS Summary:  COGS Search
BeTs to 15 clades of COG0442
COG name: Prolyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0442 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 444-561 are 50% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000606) which is seen in SYP_ECOLI.

Residues 255-367 are 40% similar to a (SYNTHETASE AMINOACYL-TRNA PROLYL-TRNA) protein domain (PD149988) which is seen in SYP_ECOLI.

Residues 368-439 are 56% similar to a (SYNTHETASE AMINOACYL-TRNA PROLYL-TRNA) protein domain (PD006954) which is seen in SYP_ECOLI.

Residues 23-219 are 72% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000380) which is seen in SYP_ECOLI.



Paralogs:  Local Blast Search


NG0566 is paralogously related to NG0295 (threonyl-tRNA synthetase (threonine--tRNA ligase)) (1e-10).


Pfam Summary:  Pfam Search
Residues 38 to 192 (E-value = 1.8e-55) place NG0566 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 247 to 385 (E-value = 2.8e-07) place NG0566 in the YbaK family which is described as YbaK / prolyl-tRNA synthetases associated domain (PF04073)
Residues 473 to 567 (E-value = 1.3e-19) place NG0566 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
230  
317
non-globular  
488  
570

PDB Hit:
pdb|1QF6|1QF6-A STRUCTURE OF E. COLI THREONYL-TRNA SYNTHETASE 54.7 4e-08
pdb|1EVK|1EVK-A CRYSTAL STRUCTURE OF A TRUNCATED FORM OF 54.7 4e-08
pdb|1H4Q|1H4Q-A PROLYL-TRNA SYNTHETASE FROM THERMUS THERMOPHILUS 52.3 2e-07
pdb|1EVK|1EVK-A CRYS

Gene Protein Sequence:
MKASQFFISTLKEAPAEAAFASHKLMIRAGLIKANASGLYTWMPMGLRVL
RKVENVVREEMARAGSVELLMPVVQPAELWQESGRWEFYGKELLRLKDRH
ERDFCMGPTCEEVIADIVRKEINSYKQLPKNFYHIQTKFRDEVRPRFGVM
RAREFVMKDAYSFHADYASLQATYDAMYDAHCRIFTRLGLAFRPVAADTG
SIGGTGSHEFQVLAESGEDVIAYSDTSDYAANIELAPTLPLKGERAAAQA
VLTKVHTPNVKTIESLVEFLNIPVEQTLKSIVVEGENEGELVLLLLRGDH
EFNDIKAEKLAGVKSPLTMASPAAIVEQFGANGGSLGPVGFTGKVYADFA
TEKGADWVIGANEDDYHYTGFNFGRDAAEPEFVDLRNVVEGDESPDGQGR
LKLARGIEVGHVFQLRGKYTQAMNVSFLDNNGKSQIMEMGCYGIGITRVV
AAAIEQNNDEKGIIWTKAMAPFEVVIVPMNYKKSDTVREAADRIYAELLA
AGADVLLDDRDERAGVLLNDSELLGIPHRIVIGDRALKEGNVEYAERRGN
EAQAVAIGEIVARVTASLNA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGCCAGCCAATTCTTTATCTCTACTTTAAAAGAAGCCCCTGCCGA
AGCCGCGTTTGCCAGCCACAAGCTGATGATTCGCGCCGGTCTGATTAAAG
CCAACGCGTCCGGTCTTTATACTTGGATGCCGATGGGGCTGCGCGTGTTA
CGCAAAGTCGAAAACGTCGTGCGCGAGGAAATGGCGCGCGCGGGCAGCGT
GGAGCTGCTGATGCCGGTGGTGCAGCCTGCCGAACTGTGGCAGGAATCCG
GCCGCTGGGAGTTTTACGGTAAAGAACTGCTGCGCCTGAAAGACCGCCAC
GAACGCGATTTCTGCATGGGCCCGACCTGCGAGGAAGTCATCGCCGACAT
CGTGCGCAAAGAAATCAACAGCTACAAACAACTGCCGAAAAATTTTTACC
ACATCCAAACCAAATTCCGCGACGAAGTGCGCCCGCGTTTCGGCGTGATG
CGCGCGCGCGAATTTGTGATGAAAGATGCTTATTCCTTCCACGCCGACTA
CGCCTCGCTTCAGGCGACCTATGATGCCATGTATGACGCTCACTGCCGCA
TCTTTACCCGTCTGGGTTTGGCGTTCCGCCCCGTCGCCGCAGACACCGGC
AGCATCGGCGGTACGGGTTCGCACGAGTTTCAAGTGTTGGCGGAAAGCGG
CGAAGATGTGATTGCATACAGCGACACTTCCGATTACGCCGCCAATATCG
AGTTGGCACCGACCTTGCCGCTTAAAGGTGAACGTGCCGCCGCTCAGGCT
GTGTTGACCAAAGTACATACACCAAACGTCAAAACCATTGAGTCTTTGGT
TGAATTCCTGAATATTCCGGTTGAACAAACCCTCAAATCCATCGTGGTTG
AAGGCGAAAACGAAGGCGAACTCGTCCTACTGCTGTTGCGTGGCGACCAT
GAGTTTAACGACATCAAGGCAGAAAAACTGGCGGGCGTAAAATCGCCACT
GACTATGGCAAGCCCTGCCGCGATTGTTGAACAATTCGGCGCAAACGGCG
GTTCGCTCGGCCCCGTCGGCTTCACAGGCAAAGTCTATGCCGATTTCGCT
ACCGAAAAAGGCGCGGACTGGGTTATCGGCGCAAACGAAGACGACTACCA
CTATACCGGCTTCAACTTCGGCCGCGATGCCGCCGAGCCTGAATTCGTCG
ATTTGCGTAATGTGGTCGAAGGCGACGAAAGCCCCGACGGGCAAGGCCGT
CTGAAACTGGCGCGCGGCATCGAAGTCGGACATGTCTTCCAGTTGCGCGG
CAAATATACCCAAGCTATGAACGTCAGCTTCCTCGACAATAACGGCAAAT
CGCAAATCATGGAAATGGGCTGCTACGGCATCGGCATCACCCGCGTCGTT
GCCGCCGCCATCGAGCAGAATAACGACGAAAAAGGCATCATTTGGACCAA
AGCGATGGCGCCGTTTGAAGTCGTCATCGTGCCGATGAACTACAAAAAAT
CCGACACTGTGCGTGAAGCCGCCGACAGAATCTATGCCGAATTGCTGGCG
GCAGGCGCGGATGTGCTGCTGGACGACCGCGACGAACGCGCAGGCGTATT
GCTGAACGATTCCGAGCTTCTCGGTATCCCGCACCGCATCGTCATCGGCG
ACCGCGCCTTGAAAGAAGGCAATGTCGAATACGCCGAACGCCGCGGCAAC
GAAGCGCAGGCAGTTGCAATCGGAGAAATTGTTGCGCGTGTAACAGCTTC
ATTAAATGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy