Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0456 IGR0454 IGR0449 IGR0455 IGR0451 IGR0453 IGR0452 IGR0450 NG0549 NG0548 NG0547 ebsC, - NG0550 ppiA, - NG0544 dnaJ, - NG0551 NG0543 mod, - NG0545 res, - NG0546 NG0549 NG0548 NG0547 ebsC, - NG0550 ppiA, - NG0544 dnaJ, - NG0551 NG0543 mod, - NG0545 res, - NG0546 Type: tandem, Name:  - 28 NG0549 NG0548 NG0547 ebsC, - NG0550 ppiA, - NG0544 dnaJ, - NG0551 NG0543 mod, - NG0545 res, - NG0546
* Calculated from Protein Sequence

Gene ID: NG0546

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
res  

Definition:
type III restriction-modification system EcoPI enzyme (type III site-specific deoxyribonuclease, subunit res)

Gene Start:
520166

Gene Stop:
523102

Gene Length:
2937

Molecular Weight*:
111424

pI*:
6.80

Net Charge*:
-1.95

EC:
3.1.21.5  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Humbelin,M., Suri,B., Rao,D.N., Hornby,D.P., Eberle,H., Pripfl,T., Kenel,S. and Bickle,T.A.
Type III DNA restriction and modification systems EcoP1 and EcoP15. Nucleotide sequence of the EcoP1 operon, the EcoP15 mod gene and some EcoP1 mod mutants. J. Mol. Biol. 200 (1), 23-29 (1988)
Medline: 88245189
Dartois,V., De Backer,O. and Colson,C.
Sequence of the Salmonella typhimurium StyLT1 restriction-modification genes: homologies with EcoP1 and EcoP15 type-III R-M systems and presence of helicase domains. Gene 127 (1), 105-110 (1993)
Medline: 93252265.

Comment:
For other 'res' genes see NG0102 (resB),NG0103(resC),NG0176
(resE),NG2124 (resA),NG0640 (res).

From GenBANK (gi:135255): This protein cuts the DNA some 25 bp to the 3' end of the recognition site. It is only required for restriction, but needs the presence of the modification enzyme and cofactors megnesium and ATP. The protein complex has two subunits, RES and MOD.

See also NG0545, subunit MOD of Type III DNA restriction and modification system.

Oklahoma ID: NGO.546

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to type III site-specific deoxyribonucleases; e.g.
residues 11-965 are 31% similar to 4584115 (AJ007510) type III restriction-modification system enzyme Res of Bacillus cereus.

Residues 1-978 are 99% similar to NMB1260, type III restriction-modification system EcoPI enzyme, subunit res, and residues 1-979 are 98% similar to NMA1466, type III site-specific deoxyribonuclease EcoP1, chain res, of N.meningitidis.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0546 is paralogously related to NG0640 (type III restriction/modification system enzyme) (2e-05).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
43
transmembrane  
99  
115
coil-coil  
920  
954

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSGFNYEKNQPHQMRAVSAVLGVFDGATPKYRTADENPELLFAAKQYANN
ILKVQSQNGIDGRFPDRSDDQNILDISMETGTGKTYTYTQTMFELHRWLG
VFKFIVVVPTLSIKAGTQQFLQSKALAEHFEQDFGGDYEGVRLKTYVVES
AKKNKGKKSNAPITIEQFVKAENKKEIHVLLINAGMVNSSSMNDTGDKAL
KDLFDNPVDALAAVRPFMIVDEPHKFPTRDSAKTWGNIKRLKPQYILRYG
ATFNDEYYNLLYRLTAVDAFNDGLVKGVRVFQEEMQGGMDAAVKLVSSDG
KEAKFELNEKDKKQTFKLAKGEDLAQIHPAISDLKIDKMNKTVVVLSNGL
ELKTGAVINPYSYSQTVQDAMMQRAVAEHFKLERALLAERAPQPKIKPLT
LFFIDDIAGYRSGNELSGSLKDKFESWIRAEAARRLKTESDPFYRDYLQK
TLDDVSACHGGYFSKDNTDSDDRIEQEINEILHDKEKLLSLDNPRRFIFS
KWTLREGWDNPNVFQICKLRSSGSTTSKLQEVGRGLRLPVNELMARVRDV
PYKLNYFVDSSEKDFVKQLVGEINDNSFQEEISKKFTEELKQKILQKYPD
IKPLVLVNQLFSDGIIDDNENFAEDGYDKLKAAYPEAFPKGLDKGKVSNA
KDEGKDTIIMREGKYEELKALWELIHHKAVLQYKIKDEAEFVDLFTAYLR
ENAAKFPQAGICTAVNEAYINNGLMLSRRIDSIEDEDFIRFNTMTYREFL
EKLAQTAKIQMQTLHQAFYRVRDELNIGDFLNMQTIAQIKNGFNRFLLHH
SFHKFELDYRLVGSKIHPTKFTNKDGKPRAVKKADLGRFEDTEHRPAAGY
LFGEIFYDSDIEHENVANNQIEGVIVFTKIPRNSIKIPVAGGGTYSPDFA
YIVKTKSGEILNFVIEAKGTDGAEDLRKSEERKIKHAEKLFAEISKEIKV
VFKTQFDGERIAELIGQNMPAGGHSENGH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGGTTTTAATTACGAGAAAAACCAGCCGCACCAAATGCGGGCGGT
TTCGGCGGTTTTGGGCGTGTTTGACGGGGCAACGCCCAAATATCGGACGG
CAGACGAAAATCCCGAACTTTTGTTTGCTGCAAAACAATACGCAAACAAT
ATCCTGAAAGTGCAAAGCCAAAACGGTATAGACGGCCGATTCCCCGACCG
TTCGGACGACCAAAATATCCTTGATATTTCCATGGAAACGGGCACGGGCA
AAACCTATACCTACACACAAACCATGTTCGAGCTGCACCGTTGGCTGGGC
GTGTTCAAATTTATCGTGGTCGTGCCGACTTTGTCCATTAAGGCGGGAAC
ACAGCAGTTTTTGCAAAGCAAGGCTTTGGCAGAGCATTTTGAACAGGATT
TCGGCGGCGATTATGAAGGCGTACGCCTGAAAACCTATGTGGTGGAAAGC
GCGAAAAAGAATAAGGGCAAAAAGTCCAATGCGCCCATAACGATTGAGCA
ATTTGTCAAAGCGGAAAACAAAAAGGAAATTCATGTGCTGCTGATTAACG
CGGGCATGGTTAATTCGTCGTCCATGAACGATACGGGCGACAAGGCATTG
AAGGATTTGTTTGACAATCCCGTTGATGCATTGGCTGCCGTGCGCCCGTT
TATGATTGTGGACGAACCGCATAAATTCCCGACCCGAGATAGCGCGAAAA
CGTGGGGCAATATCAAACGCTTAAAACCGCAATATATTTTGCGCTACGGT
GCAACATTTAACGATGAATATTACAACTTGCTTTACCGTTTGACGGCAGT
AGACGCGTTTAACGACGGGCTGGTCAAAGGCGTGCGCGTGTTTCAGGAAG
AAATGCAGGGCGGCATGGATGCGGCGGTAAAACTGGTGTCGTCGGACGGC
AAAGAAGCGAAATTTGAATTAAACGAAAAGGACAAAAAGCAGACGTTCAA
ACTGGCAAAAGGCGAAGATTTGGCGCAAATCCATCCGGCTATTTCGGATT
TGAAAATCGACAAAATGAATAAAACCGTGGTGGTGTTAAGCAACGGCTTG
GAGTTGAAAACGGGTGCCGTCATCAACCCTTATTCCTATTCGCAAACGGT
GCAGGATGCGATGATGCAGCGGGCGGTTGCCGAACATTTCAAGCTGGAAC
GCGCGCTTTTGGCAGAACGCGCGCCACAGCCCAAAATCAAGCCGCTGACG
CTGTTTTTTATTGACGATATCGCGGGCTACCGCAGCGGCAACGAGCTTTC
AGGCAGCCTGAAAGATAAATTTGAAAGCTGGATTCGCGCGGAAGCGGCAC
GCCGTCTGAAAACGGAAAGCGACCCGTTTTACCGCGATTACCTGCAAAAG
ACGTTGGACGATGTATCCGCCTGCCACGGCGGCTATTTTTCCAAAGACAA
TACAGACAGCGACGATAGAATCGAGCAGGAAATCAATGAAATCCTGCACG
ATAAGGAAAAACTGCTGTCTTTGGACAACCCGCGCCGCTTTATTTTTTCC
AAATGGACGCTGCGCGAAGGCTGGGACAATCCCAACGTTTTCCAGATTTG
CAAACTGCGTTCCAGCGGCAGCACGACTTCCAAGCTGCAAGAAGTCGGAC
GCGGCCTGCGCCTGCCGGTAAACGAGCTGATGGCGCGGGTGCGCGATGTA
CCGTACAAACTGAATTATTTTGTCGATAGCAGCGAAAAAGACTTTGTGAA
GCAGCTTGTCGGCGAAATCAACGACAATTCTTTTCAGGAAGAAATCTCCA
AAAAGTTTACCGAAGAGCTGAAACAAAAAATATTGCAAAAATACCCCGAT
ATCAAACCGCTGGTATTGGTAAACCAACTGTTTTCAGACGGCATCATTGA
CGACAATGAAAACTTTGCCGAAGACGGCTATGACAAATTAAAAGCCGCCT
ATCCCGAAGCCTTCCCCAAAGGTTTGGACAAAGGCAAAGTCAGCAACGCC
AAAGACGAGGGCAAAGACACCATCATCATGCGCGAAGGCAAATATGAAGA
ACTCAAAGCCTTGTGGGAGCTGATTCACCATAAAGCCGTTTTGCAGTACA
AAATCAAAGATGAAGCCGAATTTGTCGATTTATTTACCGCCTATTTGCGT
GAAAACGCCGCCAAATTCCCGCAGGCAGGCATATGCACGGCGGTAAACGA
AGCTTATATCAACAACGGGCTTATGCTTTCCCGCCGCATAGACAGTATTG
AAGATGAAGATTTTATCCGTTTCAACACAATGACTTACCGTGAGTTTCTG
GAAAAACTGGCACAAACGGCAAAAATCCAGATGCAGACTTTGCATCAGGC
GTTTTACCGCGTCCGCGACGAACTGAACATTGGCGATTTTTTGAATATGC
AGACCATCGCCCAAATCAAAAACGGCTTCAACCGGTTTTTGCTTCATCAT
TCCTTCCATAAATTCGAACTGGATTACCGGCTTGTCGGCAGCAAAATCCA
TCCGACCAAATTTACCAATAAAGACGGCAAACCGCGCGCGGTGAAAAAAG
CAGATTTGGGCAGATTTGAAGATACGGAGCACCGGCCTGCCGCCGGCTAT
CTCTTCGGCGAGATTTTCTACGATTCGGATATAGAACATGAAAATGTCGC
CAACAACCAAATTGAAGGCGTAATCGTATTTACCAAAATACCGAGAAACT
CCATCAAAATCCCTGTTGCCGGCGGCGGCACGTATTCGCCCGACTTTGCC
TATATCGTGAAAACCAAAAGCGGCGAGATTCTGAACTTTGTGATTGAAGC
CAAAGGGACTGACGGGGCGGAAGATTTGCGAAAAAGCGAAGAGCGGAAAA
TCAAACATGCCGAAAAGCTGTTTGCCGAGATTTCCAAAGAAATCAAGGTG
GTGTTCAAAACGCAGTTTGACGGCGAGAGGATAGCCGAACTGATCGGGCA
AAATATGCCAGCAGGCGGGCATTCTGAAAACGGACAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy