Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0449 IGR0448 IGR0445.1 IGR0450 IGR0447 IGR0445 IGR0444.1 IGR0446 NG0535 NG0537 ptpA, - NG0541 ppiA, - NG0544 glxK, - NG0540 NG0543 NG0539 NG0538 mod, - NG0545 NG0535 NG0537 ptpA, - NG0541 ppiA, - NG0544 glxK, - NG0540 NG0543 NG0539 NG0538 mod, - NG0545 Type: tandem, Name:  - 28 NG0535 NG0537 ptpA, - NG0541 ppiA, - NG0544 glxK, - NG0540 NG0543 NG0539 NG0538 mod, - NG0545 NG0542 NG0542
* Calculated from Protein Sequence

Gene ID: NG0540

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glxK  

Definition:
possible glycerate kinase

Gene Start:
514335

Gene Stop:
515225

Gene Length:
891

Molecular Weight*:
31575

pI*:
4.70

Net Charge*:
-11.26

EC:
2.7.1.31  

Functional Class:
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table
Glycerolipid metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism

Secondary Evidence:
Cusa,E., Obradors,N., Baldoma,L., Badia,J. and Aguilar,J.
Genetic analysis of a chromosomal region containing genes required
for assimilation of allantoin nitrogen and linked glyoxylate
metabolism in Escherichia coli
J. Bacteriol. 181 (24), 7479-7484 (1999)
MEDLINE: 20069628


Comment:
Oklahoma ID: NGO.540

Blast Summary:  PSI-Blast Search
Using gapped BLAST residues 1-297 are 97% similar to the 3' 297 residues of the longer conserved hypothetical protein (7226507|gb|AAF41645.1) of N. meningitidis, strain MC58 and 96% similar to N. meningitidis, strain Z2491. Residues 1-297 are 85% similar to the longer 375 residue glycerate kinase from two strains of Streptococcus pneumoniae R6 (15903078|ref|NP_358628.1) and TIGR4 (15900992|ref |NP_345596).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1929
COG name: Uncharacterized BCR
Functional Class:  S
The phylogenetic pattern of COG1929 is -------cEbrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003747 (Glycerate kinase/DUF168) with a combined E-value of 1.1e-83.
    IPB003747C    30-74
    IPB003747D    112-154
    IPB003747E    204-244


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0540 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 297 (E-value = 1.3e-22) place NG0540 in the Gly_kinase family which is described as Glycerate kinase family (PF02595)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MRYFQKEQLALFEVADLVGLGKIPLEKRNPLQIQTRGIGELIRHLISQEI
KEIYIGVGGTAGNDGGIGIAAGLGYQFYDEDGNALPACGQSLLNPASVSI
ENRYEIPEDVHIRILADVVSPLCGHQGATYTFGKQKGLDSTMFEAVDQAI
QDFYEKVPPATLKLKGAGAGGGIAGGLCAFAQASIVSGIDTCLDLIDFDK
KVSDVDLVIVGEGRLDRQSLAGKAPIGVAKRTPVGVPVVAICGSFAEDLP
SLPFENIQAAFSILEKSEPLEDSLKNASLYLEHTASNIGYLLNMPKI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCTATTTTCAAAAAGAACAACTAGCCCTATTCGAAGTTGCTGATTT
GGTTGGTCTTGGAAAAATCCCGCTAGAGAAACGAAATCCATTACAAATCC
AAACTCGTGGTATTGGAGAATTGATTCGCCACCTCATTAGTCAAGAAATT
AAAGAAATCTATATTGGCGTTGGCGGTACGGCCGGTAATGATGGAGGTAT
TGGGATTGCTGCTGGTTTAGGTTATCAATTTTATGATGAGGATGGAAATG
CCTTACCCGCTTGCGGTCAATCCTTACTAAACCCAGCTTCTGTTTCAATA
GAAAATCGCTATGAAATTCCTGAAGATGTTCACATTCGTATTTTAGCAGA
TGTTGTGAGTCCCTTATGTGGACACCAAGGTGCGACCTATACGTTTGGCA
AGCAAAAAGGGCTGGATTCTACTATGTTTGAGGCCGTAGATCAGGCAATA
CAAGATTTTTATGAAAAAGTCCCCCCTGCAACATTAAAACTTAAAGGAGC
AGGAGCTGGTGGAGGCATCGCTGGTGGTTTGTGTGCCTTTGCTCAGGCAA
GTATCGTATCTGGAATTGACACCTGCCTGGACTTGATTGACTTTGATAAG
AAAGTGTCAGATGTTGACTTGGTTATCGTTGGTGAAGGAAGACTAGATCG
TCAAAGTTTAGCAGGGAAAGCGCCTATTGGTGTAGCAAAAAGAACCCCTG
TCGGAGTTCCTGTTGTCGCTATTTGCGGCAGTTTCGCTGAAGATTTGCCT
TCCCTACCATTTGAAAATATCCAAGCTGCCTTTTCTATTTTGGAGAAAAG
TGAACCTTTAGAAGATAGTTTGAAAAATGCCAGTCTTTATTTGGAGCATA
CGGCTTCTAATATTGGATATTTATTAAATATGCCTAAGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy