Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0434 IGR0440 IGR0439 IGR0437 IGR0436 IGR0435 IGR0438 NG0525 NG0523 rci, - NG0524 yhfL,lcfA,fadD, - NG0530 tpn, - NG0528 purM, - NG0526 opuD,betT, - NG0529 NG0522 NG0525 NG0523 rci, - NG0524 yhfL,lcfA,fadD, - NG0530 tpn, - NG0528 purM, - NG0526 opuD,betT, - NG0529 NG0522 NG0525 NG0523 rci, - NG0524 yhfL,lcfA,fadD, - NG0530 tpn, - NG0528 purM, - NG0526 opuD,betT, - NG0529 NG0522 NG0527 NG0527
* Calculated from Protein Sequence

Gene ID: NG0526

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
purM  

Definition:
phosphoribosylformylglycinamidine cyclo-ligase (5'-phosphoribosyl-5-aminoimidazole synthetase) (AIR synthase)

Gene Start:
498786

Gene Stop:
499817

Gene Length:
1032

Molecular Weight*:
36885

pI*:
4.70

Net Charge*:
-12.25

EC:
6.3.3.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Smith,J.M. and Daum,H.A. 3rd.
Nucleotide sequence of the purM gene encoding 5'-phosphoribosyl-5-aminoimidazole synthetase of Escherichia coli K12. J. Biol. Chem. 261 (23), 10632-10636 (1986)
Medline: 86278135.
Schrimsher,J.L., Schendel,F.J., Stubbe,J. and Smith,J.M.
Purification and characterization of aminoimidazole ribonucleotide synthetase from Escherichia coli. Biochemistry 25 (15), 4366-4371 (1986)
Medline: 87000552.
Li,C., Kappock,T.J., Stubbe,J., Weaver,T.M. and Ealick,S.E.
X-ray crystal structure of aminoimidazole ribonucleotide synthetase (PurM), from the Escherichia coli purine biosynthetic pathway at 2.5-A resolution. Structure 7, 1155-1166 (1999)

Comment:
From GenBANK (gi:131625): Pur5 of E. coli catalyzes the reaction ATP + 5'-phosphoribosyl-formylglycinamidine = ADP + orthophosphate + 5'-phosphoribosyl-5-aminoimidazole, which is the fifth step in de novo purine biosynthesis.

For other 'pur' genes, see NG0333 (purC), NG0398 (purA), NG0263 (purF), NG0748 (purE), NG0875 (purK), NG1183 (purL), NG1224 (purN), NG1466 (purH), NG1711 (purB), NG1939 (purD)

Oklahoma ID: NGO.526

Blast Summary:  PSI-Blast Search
Numerous significant hits to phosphoribosylformylglycinamidine cyclo-ligase (5'-phosphoribosyl-5-aminoimidazole synthetase) proteins in gapped BLAST; e.g. residues 4-343 are 58% similar to gb|AAF95370.1| phosphoribosylformylglycinamidine cyclo-ligase of Vibrio cholerae, residues 3-332 are 59% similar to 10186025 phosphoribosylaminoimidazole synthetase of Escherichia coli, residues 3-332 are 58% similar to 1562541 5'-phosphoribosyl-5-aminoimidazole synthetase of Salmonella typhimurium.

Residues 1-344 are 96% similar to NMB1252, putative phosphoribosylformylglycinamidine cyclo-ligase protein, in N.meningitidis (11272453).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0150
COG name: Phosphoribosylaminoimidazol (AIR) synthetase PurM
Functional Class:  F
The phylogenetic pattern of COG0150 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 5-72 are 55% similar to a (TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN) protein domain (PD111307) which is seen in PUR2_DROPS.

Residues 3-140 are 70% similar to a (PROTEIN LIGASE SYNTHETASE) protein domain (PD000644) which is seen in P74883_SALTY.

Residues 213-332 are 49% similar to a (LIGASE SYNTHETASE PURINE PROTEIN) protein domain (PD002449) which is seen in PUR5_ECOLI.



Paralogs:  Local Blast Search


NG0526 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 163 (E-value = 7.7e-70) place NG0526 in the AIRS family which is described as AIR synthase related protein, N-terminal domain (PF00586)
Residues 174 to 342 (E-value = 3.9e-49) place NG0526 in the AIRS_C family which is described as AIR synthase related protein, C-terminal domain (PF02769)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
167  
183

PDB Hit:
pdb|1CLI|1CLI-A X-RAY CRYSTAL STRUCTURE OF AMINOIMIDAZOLE 403.0 0e+00

Gene Protein Sequence:
MSTSLSYRDAGVGIDAGDQLVEKIKPFAKRTMRPEVLGDLGGFGALVEIG
KKYQNPVLVSGTDGVGTKLKLAFDWDKHDTVGIDLVAMSVNDILVQGAEP
LFFLDYFACGKLDVPRATDVIKGIAQGCEESGCALIGGETAEMPGMYPVG
EYDLAGFAVGVVEKENVITGLSIGAGDVVLGLASNGAHSNGYSLIRKIIE
RDNPDLDAEFDNGKTLREAVIAPTRLYVKPILAALEKFTIKGMAHITGGG
ITENVPRVLPKNTVAQIDAESWELPKLFQWLQKAGNVETQEMYRTFNCGI
GMVVIVAAEDADAVRSFLSGQGETVYRLGCIRERQGNEHQTQVA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTACTTCATTGAGTTACCGCGATGCGGGCGTCGGTATCGACGCAGG
CGACCAACTGGTCGAAAAAATCAAACCGTTTGCCAAACGCACCATGCGTC
CGGAAGTATTGGGGGATTTGGGCGGTTTTGGCGCATTGGTCGAAATCGGC
AAAAAATATCAAAACCCCGTATTGGTCAGCGGTACGGACGGCGTGGGTAC
CAAGCTCAAACTTGCCTTCGATTGGGACAAACACGATACGGTGGGCATCG
ACCTTGTTGCAATGAGTGTCAACGATATTTTGGTTCAAGGAGCTGAACCA
TTGTTTTTCTTGGATTATTTTGCCTGCGGTAAATTGGATGTTCCGCGTGC
GACCGATGTCATCAAAGGCATTGCCCAAGGTTGCGAAGAATCCGGCTGCG
CCCTGATTGGCGGGGAAACTGCCGAAATGCCGGGTATGTATCCCGTTGGT
GAATACGATTTGGCGGGTTTTGCCGTCGGCGTGGTGGAAAAAGAGAATGT
CATTACCGGCCTCAGCATCGGCGCGGGCGATGTGGTATTGGGTTTGGCTT
CCAACGGCGCACATTCAAACGGCTATTCCCTTATCCGTAAAATCATCGAA
CGCGACAATCCCGATCTGGATGCCGAGTTTGATAATGGCAAAACTTTACG
TGAAGCCGTTATTGCGCCGACACGTCTGTATGTGAAACCGATTCTTGCCG
CTTTGGAAAAATTTACCATTAAAGGTATGGCGCACATTACCGGCGGCGGC
ATTACCGAAAACGTGCCGCGCGTGTTGCCTAAAAACACGGTTGCCCAAAT
CGATGCCGAATCGTGGGAATTGCCCAAGCTCTTCCAATGGCTTCAAAAGG
CGGGCAATGTGGAAACCCAAGAAATGTACCGGACCTTTAACTGCGGCATC
GGTATGGTCGTCATCGTTGCTGCCGAAGATGCCGATGCGGTTCGGTCATT
CCTGAGCGGGCAGGGCGAGACAGTGTACCGTTTGGGTTGCATCCGAGAGC
GTCAAGGGAACGAGCATCAAACCCAAGTTGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy