Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0400 IGR0402 IGR0403 IGR0397 IGR0406 IGR0398 IGR0401 IGR0405 IGR0404 IGR0407 IGR0409 IGR0408 IGR0399 NG0481 NG0482 NG0476 NG0477 NG0478 NG0479 NG0488 NG0480 NG0493 NG0483 NG0486 NG0491 NG0494 NG0487 NG0492 NG0489 NG0484 dnaB, - NG0485 NG0481 NG0482 NG0476 NG0477 NG0478 NG0479 NG0488 NG0480 NG0493 NG0483 NG0486 NG0491 NG0494 NG0487 NG0492 NG0489 NG0484 dnaB, - NG0485 Type: inverse, Name:  - 147 Type: inverse, Name:  - 164 Type: tandem, Name:  - 25 Type: inverse, Name:  - 159 Type: inverse, Name:  - 163 Type: inverse, Name:  - 156 Type: tandem, Name:  - 24 Type: inverse, Name:  - 171 Type: inverse, Name:  - 153 Type: tandem, Name:  - 23 NG0482 NG0476 NG0478 NG0479 NG0481 NG0477 NG0483 NG0494 NG0487 NG0492 NG0484 dnaB, - NG0485 NG0490 NG0491 NG0489 NG0480 NG0493 NG0486 NG0490 NG0488
* Calculated from Protein Sequence

Gene ID: NG0485

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaB  

Definition:
replicative DNA helicase

Gene Start:
467036

Gene Stop:
468394

Gene Length:
1359

Molecular Weight*:
49476

pI*:
5.30

Net Charge*:
-8.74

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Wong,A., Kean,L. and Maurer,R. Sequence of the dnaB gene of Salmonella typhimurium . J. Bacteriol. 170 (6): 2668-2675 (1988) [Medline: 88227847].

Nakayama,N., Arai,N., Bond,M.W., Kaziro,Y. and Arai,K. Nucleotide sequence of dnaB and the primary structure of the dnaB protein from Escherichia coli. The Journal of biological chemistry. 259 (1): 97-101 (1984) [Medline: 84161990].

Comment:
Oklahoma ID: NGO.485

From GenBANK (gi:1169367): In H. influenzae, DnaB participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity and contains distinct active sites for ATP binding, DNA binding, and interaction with DnaC protein, primase, and other prepriming proteins. This homohexamer belongs to the DnaB subfamily of helicases.

For other 'dna' genes, see NG0002 (dnaN), NG0078 (dnaE), NG0235 (dnaJ), NG0451 (dnaB), NG0001 (dnaA), NG0551 (dnaJ), NG0973 (dnaQ), NG0998 (dnaG), NG1110 (dnaC), NG1429 (dnaK), NG1636 (dnaC) and NG1901 (dnaJ).

Blast Summary:  PSI-Blast Search
NG0485 is orthologous to AE002441, N.meningitidis (MC58) replicative DNA helicase protein: residues 23-468 are 34% similar to residues 15-446 of NG0485.

Numerous significant hits to replicative DNA helicase proteins in gapped BLAST; e.g. residues 15-433 are 36% similar to gb|AAF83171.1|AE003888_4 replicative DNA helicase of Xylella fastidiosa, residues 15-432 are 34% similar to emb|CAB16081.1| replicative DNA helicase of Bacillus subtilis, residues 15-432 are 35% similar to 10176654 replicative DNA helicase of Bacillus halodurans.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class:  L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 38-375 are 32% similar to a (HELICASE DNA REPLICATIVE REPLICATION) protein domain (PD002663) which is seen in DNAC_BACSU.

Residues 189-419 are 24% similar to a (DNA PRIMASE/HELICASE REPLICATION) protein domain (PD043483) which is seen in PRIM_BPT3.

Residues 376-432 are 49% similar to a (HELICASE DNA REPLICATIVE REPLICATION) protein domain (PD003017) which is seen in O84505_CHLTR.



Paralogs:  Local Blast Search


NG0485 is paralogously related to NG1110 (replicative DNA helicase, phage origin) (0.0), NG0451 (replicative DNA helicase) (4e-68) and NG0367 (DNA repair protein) (4e-05).


Pfam Summary:  Pfam Search
Residues 11 to 112 (E-value = 6.6e-30) place NG0485 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 182 to 375 (E-value = 1.2e-40) place NG0485 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
38
non-globular  
107  
234

PDB Hit:
pdb|1JWE|1JWE-A NMR STRUCTURE OF THE N-TERMINAL DOMAIN OF E. 83.9 5e-17
pdb|1B79|1B79-A N-TERMINAL DOMAIN OF DNA REPLICATION PROTEIN 81.1 4e-16
pdb|1CR0|1CR0-A CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE 53.5 8e-08
pdb|1E0J|1E0J-A GP4D

Gene Protein Sequence:
MNRIEETEAVQSLASVGAEQNILGGILIEPTAIARCAILTPEKFYQAQHR
IIFRALLDMAAANEPIDIITLNDKLEARGEAENAGGLAYLIDLNQNTPSA
KNISRYVGIVNDRFVERGLLKASAAIEKIAVSKDGGTVAEKLSKAADELA
AAGKDAVKRETKTFGQTVEDLIGGLDKRLDGVRFGLPTGLMKLDGMTGGL
PDGNLIVIAARPSMGKTVLAENIARFALKQGKAVHFQSYEMSAVELARRG
MAAECNIPMQNLKTGNLTQSDYANMPIYVSQAKEWKFDVNCDLLNVDELC
FLAKEKKLTTGLDLLVVDHLHIMPRAGRDEVAELGNISRRLKNLAAELNI
PVVLVAQLNRGNTKQADKRPNMADIRGSGAIEQDANIIIMPHRESYYDGN
ENPSIAELIIAKNRDGETGTVVCGWKGQFMKFEEEPDLAWQAPKHDEYDP
YSV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCGAATCGAGGAAACGGAAGCGGTCCAATCACTGGCCAGCGTAGG
GGCGGAACAGAACATTTTGGGCGGCATCTTGATTGAACCGACGGCGATTG
CGCGGTGCGCAATCCTGACCCCTGAAAAGTTTTACCAGGCGCAACACAGG
ATTATTTTCCGCGCTCTGCTGGATATGGCGGCGGCAAACGAGCCTATCGA
CATCATCACGCTGAACGACAAGCTGGAAGCGCGCGGCGAGGCGGAAAACG
CGGGTGGCCTGGCTTACTTGATAGACCTGAACCAAAACACCCCAAGCGCG
AAGAATATCAGCCGGTACGTTGGGATTGTGAACGACAGGTTTGTCGAGCG
CGGCTTGCTGAAGGCTTCGGCGGCGATTGAAAAAATCGCGGTTTCCAAAG
ACGGCGGGACGGTCGCAGAAAAGCTGTCTAAGGCGGCCGACGAATTGGCG
GCAGCCGGCAAAGACGCGGTAAAGCGTGAAACCAAGACATTCGGCCAGAC
CGTTGAGGATTTGATTGGCGGTTTGGACAAAAGGCTTGACGGCGTGCGTT
TCGGATTGCCTACCGGCTTGATGAAGCTTGACGGGATGACCGGCGGTTTG
CCGGATGGAAACCTGATTGTGATTGCGGCGCGTCCGTCTATGGGTAAAAC
GGTTTTGGCGGAAAACATTGCGCGATTCGCGCTGAAGCAGGGCAAGGCAG
TTCATTTCCAAAGCTACGAAATGAGCGCGGTAGAGCTGGCAAGGCGCGGC
ATGGCGGCTGAGTGCAATATCCCCATGCAGAACCTGAAAACCGGCAATCT
GACGCAAAGCGATTACGCCAATATGCCGATTTACGTCAGCCAAGCGAAAG
AGTGGAAGTTTGACGTGAACTGCGACCTGCTCAACGTTGACGAGCTTTGC
TTTTTGGCTAAGGAGAAAAAACTCACTACCGGCTTGGATTTGTTGGTTGT
CGATCACCTTCACATCATGCCAAGGGCAGGGAGGGACGAGGTGGCGGAGT
TGGGGAATATATCGCGCCGTTTGAAAAACTTGGCGGCAGAGCTGAATATC
CCCGTCGTCTTGGTTGCCCAGTTGAACAGGGGAAACACAAAGCAGGCAGA
CAAACGCCCGAACATGGCAGACATTCGCGGCAGCGGCGCGATTGAGCAAG
ACGCAAACATCATCATCATGCCGCACCGCGAAAGCTACTACGACGGAAAC
GAGAATCCGAGCATTGCCGAGCTGATTATCGCCAAGAACCGGGACGGCGA
AACGGGAACGGTGGTTTGCGGCTGGAAAGGGCAATTTATGAAGTTCGAGG
AAGAGCCTGATTTGGCATGGCAAGCCCCCAAACATGATGAATATGACCCT
TACAGTGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy