Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-3 tRNA-Ser-2 IGR0380 IGR0383 IGR0381 IGR0382.1 IGR0387 IGR0379 IGR0384 IGR0386 IGR0382 IGR0385 NG0463 NG0457 NG0458 dut, - NG0459 pil, - NG0456 pilV, - NG0453 NG0452 NG0461 NG0454 NG0460 NG0462 NG0463 NG0457 NG0458 dut, - NG0459 pil, - NG0456 pilV, - NG0453 NG0452 NG0461 NG0454 NG0460 NG0462 NG0463 NG0457 NG0458 dut, - NG0459 pil, - NG0456 pilV, - NG0453 NG0452 NG0461 NG0454 NG0460 NG0462 NG0455 NG0455
* Calculated from Protein Sequence

Gene ID: NG0459

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dut  

Definition:
deoxyuridine 5`-triphosphate nucleotidohydrolase (deoxyuridinetriphosphatase) (dUTP pyrophosphatase)

Gene Start:
451837

Gene Stop:
452286

Gene Length:
450

Molecular Weight*:
16088

pI*:
4.70

Net Charge*:
-6.33

EC:
3.6.1.23  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Lundberg,L.G., Thoresson,H.O., Karlstrom,O.H. and Nyman,P.O. 1983.
Nucleotide sequence of the structural gene for dUTPase of
Escherichia coli K-12. EMBO J. 2 (6): 967-971. Medline: 84057777.


Comment:
Oklahoma ID: NGO.459

Blast Summary:  PSI-Blast Search
NG0459 is orthologous to AE002441, N.meningitidis (MC58) deoxyuridine 5`-triphosphate nucleotidohydrolase protein: residues 1-150 are 95% similar to residues 1-150 of NG0459.

Numerous significant hits to deoxyuridine 5`-triphosphate nucleotidohydrolase (deoxyuridinetriphosphatase) (dUTP pyrophosphatase) in gapped BLAST; e.g. residues 4-148 are 65% similar to dbj|BAB37938.1| deoxyuridinetriphosphatase of Escherichia coli O157:H7, residues 4-148 are 65% similar to pir||H64104 dUTP pyrophosphatase of Haemophilus influenzae (strain Rd KW20), residues 5-150 are 67% similar to gb|AAG08706.1|AE004944_10 deoxyuridine 5'-triphosphate nucleotidohydrolase of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0756
COG name: dUTPase
Functional Class:  F
The phylogenetic pattern of COG0756 is ----yq--eBrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001428 (dUTPase) with a combined E-value of 2.5e-29.
    IPB001428A    21-31
    IPB001428B    79-97
    IPB001428C    111-122
    IPB001428D    139-148


ProDom Summary:  Protein Domain Search
Residues 5-107 are 70% similar to a (DUTPASE HYDROLASE NUCLEOTIDOHYDROLASE) protein domain (PD000946) which is seen in DUT_HAEIN.

Residues 109-148 are 62% similar to a (NUCLEOTIDOHYDROLASE DUTPASE DEOXYURIDINE DUTP HYDROLASE) protein domain (PD020061) which is seen in DUT_ECOLI.

Residues 9-148 are 30% similar to a (DUTPASE DEOXYURIDINE TRIPHOSPHATE) protein domain (PD034594) which is seen in Q65243_ASF.



Paralogs:  Local Blast Search


NG0459 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 148 (E-value = 2.8e-45) place NG0459 in the dUTPase family which is described as dUTPase (PF00692)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1DUD|1DUD DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDE HYDROLASE201.0 6e-53
pdb|1MQ7|1MQ7-A CRYSTAL STRUCTURE OF DUTPASE FROM MYCOBACTERIUM 79.2 4e-16
pdb|1F7D|1F7D-A CRYSTAL STRUCTURES OF FELINE IMMUNODEFICIENCY 69.9 2e-13
pdb|1DUT|1DUT-A FIV

Gene Protein Sequence:
MNIEVEMKVLDERMADFIPAYATEGSAGLDLRACLDEEVVLQPGETFLVP
TGLAIYLANPAYAAVLLPRSGLGHKHGIVLGNLVGLIDSDYQGELKVSLW
NRGSEPFAVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEGGFGSTGSH


Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATTGAAGTAGAAATGAAAGTGTTGGACGAGAGGATGGCGGATTT
TATCCCTGCCTATGCGACGGAGGGTTCTGCAGGTTTGGATTTGCGCGCCT
GTTTGGATGAGGAAGTCGTTTTGCAGCCGGGCGAAACGTTTCTTGTGCCG
ACAGGTTTGGCAATTTATTTGGCGAATCCCGCATATGCCGCTGTTTTGCT
GCCACGTTCCGGCTTGGGGCATAAACACGGCATTGTCTTGGGCAATTTGG
TCGGTTTGATTGACTCCGATTACCAAGGGGAATTGAAGGTGTCGTTATGG
AACAGGGGTAGCGAACCGTTTGCCGTCAAGCCGTTCGAGCGTATCGCACA
AATGGTTATCGTGCCGGTCGTACAGGCGGGCTTCAAACGTGTCGAGGAAT
TTGTCGGAAGCAGCCGGGGTGAGGGCGGCTTCGGCAGTACGGGTTCTCAC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy