Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0380 IGR0381 IGR0376 IGR0378.1 IGR0376.2 IGR0376.1 IGR0379 IGR0377 IGR0382 IGR0378 NG0457 sod, - NG0450 cysW, - NG0446 NG0447 NG0448 pil, - NG0456 NG0449 pilV, - NG0453 NG0452 NG0454 dnaB, - NG0451 NG0457 sod, - NG0450 cysW, - NG0446 NG0447 NG0448 pil, - NG0456 NG0449 pilV, - NG0453 NG0452 NG0454 dnaB, - NG0451 NG0457 sod, - NG0450 cysW, - NG0446 NG0447 NG0448 pil, - NG0456 NG0449 pilV, - NG0453 NG0452 NG0454 dnaB, - NG0451 NG0455 NG0455
* Calculated from Protein Sequence

Gene ID: NG0451

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaB  

Definition:
replicative DNA helicase

Gene Start:
445521

Gene Stop:
446924

Gene Length:
1404

Molecular Weight*:
52175

pI*:
5.00

Net Charge*:
-13.54

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:
Oklahoma ID: NGO.451

For other 'dna' genes, see NG0002 (dnaN), NG0078 (dnaE), NG0235 (dnaJ), NG0001 (dnaA), NG0485 (dnaB), NG0551 (dnaJ), NG0973 (dnaQ), NG0998 (dnaG), NG1110 (dnaC), NG1429 (dnaK), NG1636 (dnaC) and NG1901 (dnaJ).

Blast Summary:  PSI-Blast Search
NG0451 is orthologous to AE002441, N.meningitidis (MC58) replicative DNA helicase protein: residues 1-468 are 97% similar to residues 1-468 of NG0451.

Numerous significant hits to replicative DNA helicase proteins in gapped BLAST; e.g. residues 1-458 are 54% similar to gb|AAK00230.1|AF229443_1 replicative DNA helicase DnaB of Pseudomonas aeruginosa, residues 13-458 are 55% similar to dbj|BAB38457.1| replicative DNA helicase DnaB of Escherichia coli O157:H7, residues 13-458 are 54% similar to gb|AAF93544.1| replicative DNA helicase of Vibrio cholerae.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class:  L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001198 (DnaB helicase) with a combined E-value of 4e-135.
    IPB001198A    21-31
    IPB001198B    107-123
    IPB001198C    203-241
    IPB001198D    249-288
    IPB001198E    330-343
    IPB001198F    349-397
    IPB001198G    429-454


ProDom Summary:  Protein Domain Search
Residues 48-396 are 49% similar to a (HELICASE DNA REPLICATIVE REPLICATION) protein domain (PD002663) which is seen in DNAB_ECOLI.

Residues 397-456 are 70% similar to a (HELICASE DNA REPLICATIVE REPLICATION) protein domain (PD003017) which is seen in O80281_BPP1.



Paralogs:  Local Blast Search


NG0451 is paralogously related to NG1110 (replicative DNA helicase, phage origin) (3e-68) and NG0485 (replicative DNA helicase) (5e-68).


Pfam Summary:  Pfam Search
Residues 19 to 121 (E-value = 2e-54) place NG0451 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 197 to 396 (E-value = 7e-135) place NG0451 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1JWE|1JWE-A NMR STRUCTURE OF THE N-TERMINAL DOMAIN OF E. 133.0 7e-32
pdb|1B79|1B79-A N-TERMINAL DOMAIN OF DNA REPLICATION PROTEIN 131.0 4e-31
pdb|1CR0|1CR0-A CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE 41.0 4e-04
pdb|1E0J|1E0J-A GP4D

Gene Protein Sequence:
MNDYAAMPPEGREVGALSLPPHSMEAEQSVLGGLMLENPAWDRIADVVSG
EDFYRHEHRLIFRSIAKLINEGRPADVITVQEDLQRNEELEAAGGFEYLI
TLAQNTPSAANIRRYAEIVRERSIMRQLAEVGTEIARSAYNPQGRDAGRL
LDEAENKVFQIAESTAKSKQGFLEMPDLLKEVVQRIDMLYSRDNPDEVTG
VPTGFIDLDKKTSGLQPGDLIIVAGRPSMGKTAFSINIAEYVAIEKHLPV
AVFSMEMGGAQLVMRMLGSVGRLDQSVLKTGRLEDEHWGRLNEAVVKLSD
APVYIDETPGLTALELRARARRLARQFNNKLGLIVIDYLQLMAASGRSDN
RASELGEISRSLKALAKELQVPIIALSQLSRTVEQRTDKRPMMSDLRESG
AIEQDADLIMFMYRDEYYNQDSPMKGLAECIIGKHRNGPVGKIFLTWTGQ
FTKFDNAAYIPEEAKIED

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGATTACGCAGCTATGCCGCCTGAAGGCCGTGAGGTCGGCGCATT
GTCGCTGCCTCCGCATTCGATGGAGGCGGAACAATCCGTTTTGGGCGGTT
TGATGCTGGAAAATCCGGCTTGGGACAGGATTGCCGATGTGGTTTCGGGA
GAGGATTTCTACCGCCACGAACACCGCCTGATTTTCCGATCCATTGCCAA
ATTAATCAATGAGGGCCGTCCCGCAGATGTGATTACGGTTCAGGAAGATT
TGCAGCGGAACGAAGAATTGGAAGCGGCAGGCGGATTTGAATATCTGATT
ACACTGGCGCAAAACACCCCGTCTGCCGCAAACATCCGCCGCTACGCCGA
AATCGTACGCGAGCGTTCCATTATGCGCCAACTCGCCGAAGTGGGGACGG
AAATCGCCCGCAGCGCATACAATCCGCAAGGCAGGGACGCGGGGCGGCTT
TTGGATGAGGCGGAAAACAAAGTGTTTCAAATCGCCGAAAGCACCGCCAA
ATCCAAGCAGGGCTTTTTGGAGATGCCCGATTTGCTGAAAGAAGTCGTAC
AGCGCATCGATATGCTTTATTCGCGCGACAATCCCGATGAAGTTACCGGC
GTACCGACAGGGTTCATCGACCTTGATAAAAAAACCTCGGGTCTGCAGCC
CGGCGACCTGATTATCGTCGCCGGCCGCCCGTCTATGGGTAAAACCGCGT
TCTCCATCAATATTGCCGAGTATGTCGCCATTGAAAAACATTTGCCCGTC
GCCGTTTTCTCGATGGAAATGGGCGGTGCGCAGTTGGTCATGCGTATGCT
CGGCTCGGTCGGACGGCTGGATCAAAGCGTTTTGAAAACCGGCAGGCTCG
AAGACGAACACTGGGGCCGTCTGAACGAAGCAGTCGTCAAACTCTCAGAC
GCGCCCGTGTACATCGACGAGACCCCGGGCCTGACTGCGCTCGAACTGCG
CGCCCGCGCCCGTCGTCTCGCCCGTCAATTTAACAATAAGCTGGGATTAA
TCGTCATTGACTACCTGCAACTGATGGCGGCATCCGGCCGTTCGGACAAC
CGCGCTTCCGAGCTTGGCGAAATTTCCCGTTCCCTCAAAGCCCTGGCAAA
AGAGTTGCAAGTCCCCATCATCGCCCTGTCGCAATTGAGCCGCACTGTCG
AACAGCGCACCGACAAACGCCCGATGATGTCCGACCTCCGCGAATCCGGT
GCTATCGAGCAGGATGCCGACCTGATTATGTTCATGTACCGCGACGAATA
CTACAACCAGGACTCACCCATGAAAGGCCTTGCCGAATGTATCATCGGCA
AACACCGCAACGGTCCCGTCGGTAAAATCTTCCTCACATGGACGGGACAA
TTCACCAAATTCGACAATGCTGCCTATATTCCCGAGGAGGCAAAGATAGA
AGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy