Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-2 tRNA-Gln-1 IGR0375 IGR0372 IGR0373 IGR0376 IGR0374 IGR0376.2 IGR0376.1 IGR0377 IGR0371 cysW, - NG0446 NG0447 cysA, - NG0445 dacC, - NG0443 NG0448 NG0449 rplY, - NG0442 ipk, - NG0440 prsA, - NG0441 ilvA, - NG0444 cysW, - NG0446 NG0447 cysA, - NG0445 dacC, - NG0443 NG0448 NG0449 rplY, - NG0442 ipk, - NG0440 prsA, - NG0441 ilvA, - NG0444 Type: tandem, Name:  - 19 cysW, - NG0446 NG0447 cysA, - NG0445 dacC, - NG0443 NG0449 rplY, - NG0442 ipk, - NG0440 prsA, - NG0441 ilvA, - NG0444 NG0448
* Calculated from Protein Sequence

Gene ID: NG0444

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ilvA  

Definition:
threonine dehydratase (threonine deaminase)

Gene Start:
438550

Gene Stop:
440073

Gene Length:
1524

Molecular Weight*:
55022

pI*:
5.80

Net Charge*:
-9.11

EC:
4.3.1.19  

Functional Class:
Amino acid biosynthesis; Branched chain amino acid family  
Amino acid biosynthesis; Pyruvate family  

Pathway: pathway table
Glycine, serine and threonine metabolism

Secondary Evidence:
Cox,J.L., Cox,B.J., Fidanza,V. and Calhoun,D.H. 1987.
The complete nucleotide sequence of the ilvGMEDA cluster of Escherichia coli K-12.
Gene 56 (2-3): 185-198.
Medline: 88056322.

Lawther,R.P., Wek,R.C., Lopes,J.M., Pereira,R., Taillon,B.E. and
Hatfield,G.W. 1987.
The complete nucleotide sequence of the ilvGMEDA operon of Escherichia coli K-12.
Nucleic Acids Res. 15 (5): 2137-2155.
Medline: 87174741.

Gallagher,D.T., Gilliland,G.L., Xiao,G., Zondlo,J., Fisher,K.E., Chinchilla,D. and Eisenstein,E. 1998.
Structure and control of pyridoxal phosphate dependent allosteric threonine deaminase.
Structure 6 (4): 465-475.
Medline: 98230745.

Guillouet S, Rodal AA, An G, Lessard PA, Sinskey AJ.
Expression of the Escherichia coli catabolic threonine dehydratase in Corynebacterium glutamicum and its effect on isoleucine
production.
Appl Environ Microbiol. 1999 Jul;65(7):3100-7.
PMID: 10388709


Comment:
See also ilvA, NG0444; ilvC, NG1233; ilvH, NG1235; ilvI, NG1236; ilvE, NG1665, and ilvD, NG0809.

Oklahoma ID: NGO.444

Blast Summary:  PSI-Blast Search
NG0444 is orthologous to AE002440, N.meningitidis (MC58) threonine dehydratase protein: residues 1-508 are 98% similar to residues 1-508 of NG0444.

Numerous significant hits to threonine dehydratase (threonine deaminase) proteins in gapped BLAST; e.g. residues 9-508 are 64% similar to gb|AAA83215.1 L-threonine deaminase of Burkholderia cepacia, residues 10-507 are 59% similar to gb|AAG03720.1|AE004471_3 threonine dehydratase, biosynthetic of Pseudomonas aeruginosa, resiudes 8-507 are 59% similar to 7436913 threonine dehydratase of Synechocystis sp. (strain PCC 6803).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1171
COG name: Threonine dehydratase
Functional Class:  E
The phylogenetic pattern of COG1171 is ----Y-vcEbrh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001721 (C-terminal domain of threonine dehydratase) with a combined E-value of 8e-152.
    IPB001721A    46-90
    IPB001721B    148-170
    IPB001721C    178-213
    IPB001721D    218-271
    IPB001721E    302-345
***** IPB000634 (Serine/threonine dehydratase pyridoxal-phosphate attachment site) with a combined E-value of 1.6e-21.
    IPB000634A    45-59
    IPB000634B    180-190
    IPB000634C    236-255
***** IPB001926 (Pyridoxal-5'-phosphate-dependent enzymes, beta family) with a combined E-value of 8.7e-11.
    IPB001926A    76-103
***** IPB001216 (Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site) with a combined E-value of 8e-06.
    IPB001216B    42-86
    IPB001216C    88-137
    IPB001216D    145-185


ProDom Summary:  Protein Domain Search
Residues 156-322 are 60% similar to a (DEHYDRATASE DEAMINASE THREONINE LYASE PYRIDOXAL) protein domain (PD002811) which is seen in THD1_BURCE.

Residues 323-507 are 56% similar to a (THREONINE DEHYDRATASE DEAMINASE) protein domain (PD007543) which is seen in THD1_BURCE.

Residues 19-155 are 67% similar to a (LYASE PYRIDOXAL PHOSPHATE SYNTHASE BIOSYNTHESIS) protein domain (PD000323) which is seen in P73375_SYNY3.



Paralogs:  Local Blast Search


NG0444 is paralogously related to NG0340 (cysteine synthase) (3e-08).


Pfam Summary:  Pfam Search
Residues 19 to 312 (E-value = 1.3e-99) place NG0444 in the PALP family which is described as Pyridoxal-phosphate dependent enzyme (PF00291)
Residues 324 to 413 (E-value = 3.8e-32) place NG0444 in the Thr_dehydrat_C family which is described as C-terminal regulatory domain of Threonine dehydratase (PF00585)
Residues 418 to 507 (E-value = 2.7e-36) place NG0444 in the Thr_dehydrat_C family which is described as C-terminal regulatory domain of Threonine dehydratase (PF00585)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
179  
195

PDB Hit:
pdb|1TDJ|1TDJ THREONINE DEAMINASE (BIOSYNTHETIC) FROM E. COLI 503.0 0e+00
pdb|1J6N|1J6N-A CRYSTAL STRUCTURE OF CYSTEINE SYNTHASE (TM0665) 50.8 6e-07
pdb|1M54|1M54-A CYSTATHIONINE-BETA SYNTHASE: REDUCED VICINAL 41.0 5e-04
pdb|1JBQ|1JBQ-A STRU

Gene Protein Sequence:
MNTPLPYSDYLIRILTASVYDVAVETPLEPARSLSVRLKNNILLKREDLQ
PVFSFKIRGAYNKMSKLPKDALACGVIAASAGNHAQGVALSAQRLGCRAV
IVMPETTPKIKVDAVKSRGGEVVLRGVSYNDAYDYAMELAEQEGLTYIAP
FDDPDVIAGQGTVGMEIVSQHPDPIRAVFVPIGGGGLAAGVAAFIKQVRP
EIKVIGVQTNDSCCMKQSVEAGEIVHLKDVGLFSDGTAVKVVGNGTFRLC
KELLDEIITVDTDAVCGAVKDIFDDTRSITEPAGALALAGLKAYIAREGA
ENQTLIAVTSGANMNFHRLRHVSERSELGEGNEGIFAVTIPEERGSFLKF
VNILGNRNITEFNYRYGGDEKAHIFVGLQAAGPQDLAVIGSRLDEAGLPN
VDLTNNEIAKIHIRYMVGGRTDKVGHERLVSFEFPERPGALARFLNHMQG
GWNITLFHYRNHGADYGRILVGIDVPPHDAAAFDGFLESLGYSYHEETQN
AAYKLFLA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACGCCCCTTCCTTATTCCGATTACCTCATCCGCATCCTGACGGC
ATCTGTCTATGATGTAGCGGTCGAAACGCCTTTGGAACCGGCACGCAGCC
TTTCTGTACGTTTGAAAAACAACATCCTTTTGAAACGCGAAGATTTGCAG
CCGGTTTTTTCGTTCAAAATACGCGGCGCGTACAACAAAATGTCCAAGTT
GCCGAAAGATGCGCTCGCTTGCGGCGTGATTGCGGCAAGCGCGGGCAATC
ACGCACAAGGCGTGGCGTTGTCCGCACAGCGTTTGGGCTGCCGTGCCGTT
ATCGTCATGCCGGAGACTACGCCGAAAATTAAAGTGGATGCGGTTAAAAG
CCGTGGCGGCGAGGTGGTTTTGCGGGGTGTTTCATACAACGATGCCTACG
ATTATGCGATGGAGCTGGCGGAACAGGAAGGGCTGACCTATATCGCGCCG
TTTGACGATCCCGATGTGATTGCGGGACAGGGGACGGTGGGGATGGAAAT
TGTCAGCCAGCATCCCGATCCAATCCGCGCCGTATTCGTACCGATAGGGG
GCGGCGGTTTGGCGGCGGGCGTGGCGGCATTTATCAAACAGGTTCGTCCC
GAAATTAAAGTTATCGGCGTACAGACCAACGATTCCTGCTGTATGAAGCA
GTCGGTCGAAGCAGGCGAAATCGTCCATTTGAAAGATGTCGGGCTGTTTT
CAGACGGTACGGCGGTCAAAGTCGTCGGAAACGGAACCTTCCGCCTCTGC
AAAGAACTTTTGGATGAAATCATTACAGTCGATACCGATGCGGTTTGCGG
CGCGGTCAAGGATATTTTCGATGACACGCGCAGCATTACCGAGCCGGCCG
GCGCGTTGGCGTTGGCGGGTCTGAAAGCCTATATTGCCCGAGAAGGTGCG
GAAAACCAAACCCTGATTGCCGTTACCAGCGGTGCGAATATGAATTTTCA
CCGTTTGCGCCACGTTTCGGAACGGAGCGAATTGGGCGAGGGCAACGAAG
GTATTTTTGCCGTTACCATCCCCGAAGAACGCGGCAGCTTCCTTAAGTTT
GTCAATATATTGGGAAATAGGAATATTACCGAGTTCAACTACCGCTACGG
CGGCGATGAAAAAGCGCATATCTTTGTCGGACTTCAAGCGGCAGGCCCGC
AGGATTTGGCGGTTATCGGCAGCCGGTTGGATGAGGCGGGATTGCCCAAT
GTCGATTTGACCAATAATGAGATTGCCAAAATCCATATCCGCTATATGGT
CGGAGGGCGGACGGACAAAGTAGGGCACGAGCGTCTGGTCAGTTTTGAGT
TTCCGGAGCGTCCGGGCGCGTTGGCGCGCTTTTTGAACCATATGCAGGGC
GGTTGGAACATTACGCTCTTCCATTACCGCAACCACGGTGCGGATTACGG
GCGGATTTTGGTCGGTATCGACGTGCCGCCGCACGATGCCGCCGCATTTG
ACGGTTTCTTGGAAAGTCTGGGATACAGCTATCACGAGGAAACGCAAAAT
GCCGCGTACAAGCTGTTTCTTGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy