Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-2 tRNA-Gln-1 IGR0370 IGR0375 IGR0372 IGR0373 IGR0369.2 IGR0376 IGR0374 IGR0376.1 IGR0371 cysW, - NG0446 NG0447 cysA, - NG0445 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444 cysW, - NG0446 NG0447 cysA, - NG0445 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444 Type: tandem, Name:  - 19 cysW, - NG0446 NG0447 cysA, - NG0445 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444
* Calculated from Protein Sequence

Gene ID: NG0443

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dacC  

Definition:
penicillin-binding protein (D-alanyl-D-alanine carboxypeptidase)

Gene Start:
438401

Gene Stop:
437235

Gene Length:
1167

Molecular Weight*:
42689

pI*:
10.50

Net Charge*:
16.89

EC:
3.4.16.4  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.443c

Blast Summary:  PSI-Blast Search
NG0443 is orthologous to AE002440, N.meningitidis (MC58) penicillin-binding protein: residues 1-389 are 96% similar to residues 1-389 of NG0443. NG0443 is orthologous to AL162755, N.meningitidis (Z2491) putative D-alanyl-D-alanine carboxypeptidase protein: residues 1-389 are 95% similar to residues 1-389 of NG0443.

Numerous significant hits to penicillin-binding protein (D-alanyl-D-alanine carboxypeptidase) proteins in gapped BLAST; e.g. residues 41-383 are 33% similar to gb|AAD32234.1|AF147448_5 penicillin-binding protein 5 of Pseudomonas aeruginosa, residues 40-385 are 34% similar to 9971925 predicted penicillin-binding protein 6 precursor of uncultured proteobacterium EBAC31A08, residues 31-386 are 35% similar to gb|AAF94109.1| D-alanyl-D-alanine carboxypeptidase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1686
COG name: D-alanyl-D-alanine carboxypeptidase
Functional Class:  M
The phylogenetic pattern of COG1686 is --------EBRH----olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR00725 (D-Ala-D-Ala carboxypeptidase 1 (S11) family signature) with a combined E-value of 2.6e-12.
    PR00725A    71-82
    PR00725B    124-141
    PR00725C    152-165


ProDom Summary:  Protein Domain Search
Residues 30-127 are 34% similar to a (CARBOXYPEPTIDASE PROTEIN PRECURSOR PENICILLIN-BINDING) protein domain (PD003893) which is seen in DACC_ECOLI.

Residues 128-278 are 41% similar to a (PROTEIN CARBOXYPEPTIDASE PENICILLIN-BINDING PRECURSOR) protein domain (PD003024) which is seen in DACC_ECOLI.



Paralogs:  Local Blast Search


NG0443 is paralogously related to NG0327 (penicillin-binding protein 4 (D-alanyl-D-alanine-endopeptidase)) (3e-14).


Pfam Summary:  Pfam Search
Residues 35 to 266 (E-value = 8.1e-60) place NG0443 in the Peptidase_S11 family which is described as D-alanyl-D-alanine carboxypeptidase (PF00768)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
22
cleavable N-terminal sequence  
1  
23

PDB Hit:
pdb|1HD8|1HD8-A CRYSTAL STRUCTURE OF A DEACYLATION-DEFECTIVE 194.0 3e-50
pdb|1ES4|1ES4-A C98N MUTANT OF STREPTOMYCES K15 85.4 1e-17
pdb|1ES3|1ES3-A C98A MUTANT OF STREPTOMYCES K15 82.3 1e-16
pdb|1ES2|1ES2-A S96A

Gene Protein Sequence:
MTAHKILPVLLPIILGVSHATAASPAPNRPTVHAAPTLQTPETLTAAHIV
IDLQSRQTLSAKNTNTPVEPAALTQLMTAYLVFKNMKSGNIQSEENLKIP
ESAWASEGSRMFVRPGDTVSTDKLLKGMIALCANDAALTLADRLGNGSIE
NFVQQMNKEARRLGMKNTVFKNPTGLGREGQVSTAKDLSLLSEALMRDFP
EYYPLFSIKSFKFENIEQNNRNILLYRDNNVNGLKAGHTESGGYNLAVSY
SGNGRHILVITLGSESAETRASDNSKLLNRALQAFDTPKIYPKGKTVAQI
QISGGSKKTVRAGFLKEAYITLPHKEAKMAEQILETIQPIPAPVKKGQIL
GKIKIRQNGHTIAEKEIVALENVEKRSRWQRLWTRLTGQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGCACATAAAATCCTGCCCGTCCTTCTTCCCATCATCTTAGGCGT
TTCTCACGCAACGGCTGCATCGCCCGCGCCCAACAGACCGACGGTACACG
CCGCCCCCACGCTCCAAACACCCGAAACCCTCACGGCGGCACACATCGTT
ATCGACCTTCAAAGCAGGCAGACTTTATCCGCCAAAAACACCAATACCCC
TGTCGAACCGGCGGCACTAACCCAACTGATGACCGCATATTTGGTTTTCA
AAAACATGAAATCGGGAAATATCCAATCTGAAGAAAACTTAAAAATACCC
GAATCCGCATGGGCTTCAGAAGGAAGCAGAATGTTTGTACGTCCCGGCGA
TACGGTCAGCACCGACAAACTCTTAAAAGGCATGATTGCCCTATGCGCAA
ACGATGCCGCCCTAACCCTTGCCGACCGGCTGGGCAACGGCTCGATTGAA
AATTTTGTGCAACAAATGAACAAAGAAGCCCGACGCTTGGGCATGAAGAA
CACCGTATTCAAAAACCCGACAGGCTTGGGTAGAGAAGGACAGGTTTCCA
CCGCCAAAGACCTCTCCCTGCTGTCTGAAGCATTGATGCGCGACTTTCCG
GAATATTACCCGCTGTTTTCCATCAAATCGTTCAAGTTTGAAAACATAGA
ACAAAACAACCGCAATATCCTTTTATATAGGGACAACAATGTAAACGGCC
TGAAAGCCGGGCACACAGAAAGCGGCGGCTACAACCTTGCCGTGTCATAC
TCCGGCAACGGCAGGCACATCCTTGTCATCACACTAGGTTCGGAATCGGC
GGAAACCCGCGCATCGGACAACAGCAAGCTGCTGAACCGGGCATTGCAGG
CCTTCGATACGCCCAAAATATATCCGAAAGGCAAAACCGTTGCCCAAATC
CAAATTTCCGGAGGCAGCAAAAAAACCGTCCGCGCAGGCTTCCTCAAAGA
AGCCTACATCACTCTGCCACATAAAGAAGCGAAAATGGCAGAACAGATTT
TGGAAACCATACAGCCGATTCCCGCCCCGGTAAAAAAAGGGCAGATTTTA
GGAAAAATCAAAATCAGGCAAAACGGACATACCATTGCCGAAAAAGAAAT
CGTCGCACTGGAAAACGTAGAAAAAAGAAGCCGGTGGCAAAGGCTTTGGA
CGCGTCTGACAGGGCAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy