Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-2 tRNA-Gln-1 IGR0369.1 IGR0370 IGR0375 IGR0372 IGR0373 IGR0369.2 IGR0374 IGR0369 IGR0371 cysA, - NG0445 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 NG0438 panC, - NG0437 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444 cysA, - NG0445 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 NG0438 panC, - NG0437 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444 Type: tandem, Name:  - 19 cysA, - NG0445 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 NG0438 panC, - NG0437 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444
* Calculated from Protein Sequence

Gene ID: NG0441

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
prsA  

Definition:
ribose-phosphate pyrophosphokinase (phosphoribosyl pyrophosphate synthetase)

Gene Start:
435484

Gene Stop:
436464

Gene Length:
981

Molecular Weight*:
35557

pI*:
5.30

Net Charge*:
-4.45

EC:
2.7.6.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Pentose phosphate cycle
Purine metabolism

Secondary Evidence:
Hove-Jensen,B., Harlow,K.W., King,C.J. and Switzer,R.L. 1986. Phosphoribosylpyrophosphate synthetase of Escherichia coli.
Properties of the purified enzyme and primary structure of the prs
gene. J. Biol. Chem. 261 (15): 6765-6771. Medline: 86196114.

Bower,S.G., Harlow,K.W., Switzer,R.L. and Hove-Jensen,B. 1989. Characterization of the Escherichia coli prsA1-encoded mutant
phosphoribosylpyrophosphate synthetase identifies a divalent
cation-nucleotide binding site. J. Biol. Chem. 264 (17): 10287-10291. Medline: 89255522.


Comment:
Oklahoma ID: NGO.441

Blast Summary:  PSI-Blast Search
NG0441 is orthologous to AL162755, N.meningitidis (Z2491) putative ribose-phosphate pyrophosphokinase protein: residues 1-327 are 99% similar to residues 1-327 of NG0441.

Numerous significant hits to ribose-phosphate pyrophosphokinase (phosphoribosyl pyrophosphate synthetase) in gapped BLAST; e.g. residues 7-315 are 70% similar to gb|AAG08057.1|AE004880_13 ribose-phosphate pyrophosphokinase of Pseudomonas aeruginosa, residues 7-315 are 66% similar to gb|AAC74291.1| phosphoribosylpyrophosphate synthetase of Escherichia coli K12, residues 7-315 are 65% similar to pir||KIEBRT ribose-phosphate pyrophosphokinase of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0462
COG name: Phosphoribosylpyrophosphate synthetase
Functional Class:  F,E
The phylogenetic pattern of COG0462 is AmtkYqvcebrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000842 (Phosphoribosyl pyrophosphate synthetase) with a combined E-value of 1.3e-157.
    IPB000842A    37-79
    IPB000842B    108-153
    IPB000842C    166-193
    IPB000842D    194-248
    IPB000842E    251-278
    IPB000842F    292-315
***** IPB002375 (Purine/pyrimidine phosphoribosyl transferase) with a combined E-value of 3.6e-06.
    IPB002375B    215-230


ProDom Summary:  Protein Domain Search
Residues 207-263 are 64% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE) protein domain (PD000249) which is seen in KPRS_ECOLI.

Residues 37-205 are 71% similar to a (SYNTHETASE PYROPHOSPHOKINASE RIBOSE-PHOSPHATE) protein domain (PD001439) which is seen in KPRS_SALTY.

Residues 264-312 are 61% similar to a (SYNTHETASE RIBOSE-PHOSPHATE PYROPHOSPHOKINASE) protein domain (PD001988) which is seen in KPRS_HAEIN.

Residues 193-263 are 36% similar to a (SYNTHETASE-ASSOCIATED PROTEIN) protein domain (PD016748) which is seen in O60256_HUMAN.



Paralogs:  Local Blast Search


NG0441 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 143 to 271 (E-value = 3.3e-29) place NG0441 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1DKR|1DKR-A CRYSTAL STRUCTURES OF BACILLUS SUBTILIS 321.0 1e-88
pdb|1AO0|1AO0-A GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE (PRPP) 39.5 8e-04
pdb|1GPH|1GPH-1 GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE (PRPP) 39.2 0.001000
pdb|1DKR|1DKR-A CR

Gene Protein Sequence:
MAAYDSLMVFTGNANPELAQRVVRHLDISLGNASVSKFSDGEVAVELLEN
VRGRDVFILQPTCAPTNDNLMEILTMADALKRASAGRITTAIPYFGYARQ
DRRPRSVRVPISAKLVANMLYSAGIDRVLTVDLHADQIQGFFDIPVDNIY
ATPILLNDIKQQRIENLTVVSPDIGGVVRARAVAKSLNADLAIIDKRRPK
ANVAEVMNIIGDIQGKTCLIVDDMIDTANTLCKAAVALKERGAERVLAYA
SHAVFSGEAVSRIASSEIDQVVVTDTIPLSEAAKNCDRIRQVTIAGLLAE
TVRRISNEESVSYLFNEEVMTGSMLLP

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGCGTACGACAGTTTGATGGTATTTACAGGCAATGCCAATCCCGA
ATTGGCACAACGTGTTGTCAGGCATTTGGACATTTCTTTGGGCAATGCTT
CCGTATCCAAGTTTTCAGACGGCGAAGTTGCCGTCGAACTGTTGGAAAAC
GTACGCGGGCGCGACGTTTTCATCCTTCAGCCGACCTGTGCGCCGACCAA
TGACAACCTGATGGAAATCCTGACGATGGCGGATGCACTGAAGCGTGCTT
CGGCAGGTCGTATTACCACAGCCATTCCGTATTTCGGCTATGCGCGCCAA
GACCGCCGTCCGCGTTCCGTCCGCGTTCCGATTTCTGCCAAACTGGTGGC
AAATATGCTGTATTCGGCAGGGATCGACCGTGTTTTGACTGTCGATTTGC
ATGCCGACCAGATTCAAGGTTTCTTCGATATTCCGGTGGACAATATTTAT
GCCACTCCGATTTTGTTGAACGACATCAAGCAGCAGCGGATTGAAAATCT
GACCGTCGTCAGCCCGGACATCGGCGGTGTCGTCCGCGCCCGCGCCGTTG
CAAAATCCCTGAATGCCGACTTGGCAATCATCGACAAACGCCGCCCGAAA
GCCAATGTGGCGGAAGTCATGAACATCATCGGCGATATTCAAGGCAAAAC
CTGTCTGATTGTGGACGATATGATTGACACTGCAAATACGCTGTGCAAAG
CCGCCGTCGCCTTGAAAGAGCGCGGTGCAGAACGTGTCTTGGCTTATGCC
AGCCACGCCGTATTCTCCGGAGAGGCGGTCAGCCGTATTGCCTCATCCGA
AATCGACCAGGTGGTCGTAACCGATACCATTCCTTTGTCTGAAGCGGCTA
AAAACTGCGACCGTATCCGTCAGGTAACGATTGCAGGTTTGTTGGCCGAA
ACCGTCCGCCGCATTAGCAATGAAGAATCCGTCTCATATCTTTTCAATGA
AGAAGTGATGACAGGCAGCATGTTGCTGCCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy