Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-2 tRNA-Gln-1 IGR0369.1 IGR0370 IGR0372 IGR0368 IGR0373 IGR0369.2 IGR0374 IGR0369 IGR0371 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444 Type: tandem, Name:  - 19 dacC, - NG0443 rplY, - NG0442 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 prsA, - NG0441 NG0438.1 ilvA, - NG0444
* Calculated from Protein Sequence

Gene ID: NG0440

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ipk  

Definition:
probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) (probable isopentenyl monophosphate kinase)

Gene Start:
434300

Gene Stop:
435142

Gene Length:
843

Molecular Weight*:
30975

pI*:
8.70

Net Charge*:
3.82

EC:
2.7.1.-  

Functional Class:
Unassigned  

Pathway: pathway table
Inositol phosphate metabolism
Nicotinate and nicotinamide metabolism
Porphyrin and chlorophyll metabolism
Sphingoglycolipid metabolism
Starch and sucrose metabolism

Secondary Evidence:
Lange,B.M. and Croteau,R. 1999. Isopentenyl diphosphate biosynthesis via a mevalonate-independent pathway: isopentenyl monophosphate kinase catalyzes the terminal enzymatic step. Proc. Natl. Acad. Sci. U.S.A. 96 (24): 13714-13719. Medline: 20040616.

Kuzuyama,T., Takagi,M., Kaneda,K., Watanabe,H., Dairi,T. and Seto,H. 2000. Studies on the nonmevalonate pathway: Conversion of 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol to its 2-phospho derivative by 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase. Tetrahedron Lett. 41: 2925-2928.

Comment:
Oklahoma ID: NGO.440

Blast Summary:  PSI-Blast Search
NG0440 is orthologous to Q9JZW4, N.meningitidis (serogroup B) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase): residues 1-281 are 91% similar to residues 1-281 of NG0440.

Numerous significant hits in gapped BLAST; e.g. residues 7-272 are 45% similar to gb|AAG08056.1|AE004880_12 isopentenyl monophosphate kinase of Pseudomonas aeruginosa, residues 10-278 are 41% similar to 549526 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) of Salmonella typhimurium, residues 7-278 are 41% similar to gb|AAF29530.1|AF216300_1 4-diphosphocytidyl-2C-methyl-D-erythritol kinase of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1947
COG name: Uncharacterized ACR, YchB/YabH family
Functional Class:  S
The phylogenetic pattern of COG1947 is -----qvcebrhuj---li--
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 205-278 are 37% similar to a (PROTEIN INTERGENIC REGION HEMM-PRSA) protein domain (PD024009) which is seen in YCHB_HAEIN.

Residues 7-184 are 42% similar to a (PROTEIN INTERGENIC REGION CONSERVED) protein domain (PD008614) which is seen in YCHB_ECOLI.



Paralogs:  Local Blast Search


NG0440 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 88 to 252 (E-value = 1.2e-33) place NG0440 in the GHMP_kinases family which is described as GHMP kinases putative ATP-binding protein (PF00288)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
130  
146

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDTVYLKP
RDDGKIILHNPVGGIPQEADLSYRAASLLQKYARNLAGVEIWLDKKIPTG
AGLGGGSSDAATVLLVLNRWWQCGLTQWQLIDLGAALGADVPFFIFGKNA
FASGIGKKLIGMDIPKQWYVIVKPPVHVSTAKIFTYEGLTRDSASSIMPT
FQNLQPFRNDMQAVVFKEYPEVWKAYSELSKYGSAMMTGSGACIFAAFQA
RNSAYNIYRQVSGLYEAYLAEGLSKHPLLSV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATTGCGGACGGACGGCAGGCGTTTCCCGCACCTGCAAAACTGAA
TCTCGATTTGAGGATTACCGGCAGGCGGGAAGACGGTTATCACAATATCG
AAAGCATATTCTGCCTGATAGATTTGCAGGATACCGTATATTTGAAACCG
AGGGACGACGGCAAAATCATCCTGCACAATCCTGTCGGCGGAATACCGCA
GGAAGCCGATTTGAGCTACCGTGCCGCATCGTTGCTGCAAAAATATGCGC
GCAACCTTGCCGGCGTGGAAATATGGCTGGACAAAAAAATCCCGACCGGC
GCCGGCTTGGGAGGGGGGAGTTCCGATGCCGCAACGGTTTTGCTGGTGTT
GAACCGTTGGTGGCAGTGTGGTTTGACGCAGTGGCAGCTCATTGATTTGG
GTGCGGCTTTGGGTGCGGACGTACCGTTTTTTATTTTCGGAAAAAATGCT
TTTGCAAGCGGGATAGGTAAAAAACTGATAGGAATGGATATTCCGAAACA
GTGGTATGTTATTGTCAAACCTCCCGTCCACGTTTCCACCGCAAAAATTT
TCACATACGAAGGCTTGACACGGGATTCTGCCTCAAGCATAATGCCGACT
TTCCAAAACCTGCAACCGTTCAGAAACGATATGCAGGCAGTGGTATTTAA
AGAATACCCTGAAGTTTGGAAAGCTTATTCCGAGTTGTCGAAATACGGTT
CTGCAATGATGACCGGCTCAGGAGCCTGTATATTTGCAGCATTTCAAGCT
AGGAATAGCGCATACAATATATACCGACAAGTTTCAGGTTTGTACGAGGC
ATATTTGGCAGAGGGTCTTTCAAAACATCCTTTGTTGTCCGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy