Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-2 tRNA-Gln-1 tRNA-Thr-1 IGR0369.1 IGR0370 IGR0363.1 IGR0366 IGR0365 IGR0368 IGR0369.2 IGR0364 IGR0369 IGR0371 IGR0367 NG0431 NG0432 NG0434 NG0435 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 NG0433 prsA, - NG0441 NG0438.1 NG0431 NG0432 NG0434 NG0435 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 NG0433 prsA, - NG0441 NG0438.1 Type: tandem, Name:  - 19 NG0432 NG0434 NG0435 NG0431 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 NG0433 prsA, - NG0441 NG0438.1
* Calculated from Protein Sequence

Gene ID: NG0437

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
panC  

Definition:
pantoate--beta-alanine ligase (pantothenate synthetase) (pantoate activating enzyme)

Gene Start:
430569

Gene Stop:
431402

Gene Length:
834

Molecular Weight*:
30986

pI*:
6.50

Net Charge*:
-1.63

EC:
6.3.2.1  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pantothenate  

Pathway: pathway table
beta-Alanine metabolism
Pantothenate and CoA biosynthesis

Comment:
Oklahoma ID: NGO.437

For other 'pan' genes, see NG0436 (panB), NG0620 (panD).

Blast Summary:  PSI-Blast Search
NG0437 is orthologous to AL162755, N.meningitidis (Z2491) putative pantoate--beta-alanine ligase protein: residues 1-278 are 88% similar to residues 1-278 of NG0437.

Numerous significant hits to pantoate--beta-alanine ligase (pantothenate synthetase) (pantoate activating enzyme) in gapped BLAST; e.g. residues 1-277 are 51% similar to gb|AAG08116.1|AE004886_8 pantoate--beta-alanine ligase of Pseudomonas aeruginosa, residues 1-277 are 51% similar to pir||E64736 pantoate--beta-alanine ligase of Escherichia coli, residues 3-274 are 51% similar to emb|CAA89958.1| putative pantoate--beta-alanine ligase of Schizosaccharomyces pombe.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0414
COG name: Pantoate-beta-alanine ligase
Functional Class:  H
The phylogenetic pattern of COG0414 is ----yqvcebr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003721 (Pantoate-beta-alanine ligase) with a combined E-value of 8.7e-101.
    IPB003721A    47-74
    IPB003721B    113-157
    IPB003721C    158-203
    IPB003721D    259-272


ProDom Summary:  Protein Domain Search
Residues 8-193 are 58% similar to a (LIGASE PANTOTHENATE SYNTHETASE) protein domain (PD006306) which is seen in PANC_ECOLI.

Residues 196-274 are 39% similar to a (LIGASE PANTOTHENATE SYNTHETASE) protein domain (PD008486) which is seen in PANC_SCHPO.



Paralogs:  Local Blast Search


NG0437 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 275 (E-value = 1.5e-129) place NG0437 in the Pantoate_ligase family which is described as Pantoate-beta-alanine ligase (PF02569)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
200  
230

PDB Hit:
pdb|1IHO|1IHO-A CRYSTAL APO-STRUCTURE OF PANTOTHENATE SYNTHETASE259.0 4e-70

Gene Protein Sequence:
MQIIHTIRELRTWRENIGKVAFVPTMGNLHEGHLALVREARKRADNVVVS
IFVNRLQFGQGEDFDKYPRTLQQDADKLAAEGVAVVFAPDEKELYPNVEQ
RYNVEPPHLQNELCGKFRPGHFRGVATVVSKLFNIVLPDVACFGKKDYQQ
LAVIKGLTEDLNFDIEIVPVDTGRAADGLALSSRNRYLSVGERAEAPRLY
RELQAVAESLKQAGLDYAGLERQAADHLTAAGWLVDYVEIRRADTLEMAR
AGDKKLVVLAAARLGTTRLIDNVEVGLP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAATCATACATACCATTCGAGAACTGCGCACGTGGCGTGAAAATAT
AGGAAAGGTGGCATTTGTGCCGACCATGGGCAATCTGCATGAAGGGCATC
TTGCCCTTGTTCGCGAAGCCAGAAAACGCGCCGACAACGTTGTTGTCAGC
ATATTCGTCAACCGCTTGCAATTCGGTCAGGGCGAGGATTTCGACAAATA
TCCGCGTACTTTGCAACAGGATGCGGACAAACTTGCCGCCGAAGGCGTTG
CCGTTGTTTTCGCGCCCGATGAGAAAGAACTCTATCCGAACGTGGAACAG
CGTTACAACGTCGAACCGCCCCATTTGCAAAACGAATTGTGCGGCAAATT
CCGCCCCGGCCATTTTCGCGGCGTGGCGACGGTGGTGTCCAAGCTGTTCA
ATATCGTTTTGCCGGATGTTGCCTGTTTCGGCAAAAAAGATTACCAGCAG
CTTGCCGTGATTAAAGGTTTGACCGAGGATTTGAATTTCGATATCGAAAT
TGTCCCCGTCGATACGGGGCGGGCGGCGGACGGTTTGGCACTCTCCAGCC
GCAACCGGTACTTGAGCGTTGGGGAACGCGCCGAAGCACCGCGCCTGTAC
CGCGAGCTGCAGGCTGTTGCCGAATCGCTGAAGCAGGCCGGTTTGGATTA
TGCGGGTTTGGAGCGGCAGGCTGCCGACCATTTGACCGCTGCGGGCTGGC
TGGTCGATTATGTGGAAATCCGCCGCGCCGATACGCTCGAAATGGCGCGG
GCGGGAGATAAGAAACTGGTGGTCTTGGCCGCCGCCCGTCTGGGGACGAC
GCGTCTGATTGACAATGTGGAAGTCGGCCTGCCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy