Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-1 IGR0369.1 IGR0370 IGR0363.1 IGR0366 IGR0365 IGR0368 IGR0369.2 IGR0364 IGR0369 IGR0363 IGR0367 IGR0362 NG0431 NG0430 NG0432 NG0434 NG0435 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 NG0433 NG0438.1 NG0431 NG0430 NG0432 NG0434 NG0435 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 NG0433 NG0438.1 NG0430 NG0432 NG0434 NG0435 NG0431 lolB, - NG0439 NG0438 panB, - NG0436 panC, - NG0437 ipk, - NG0440 NG0433 NG0438.1
* Calculated from Protein Sequence

Gene ID: NG0436

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
panB  

Definition:
3-methyl-2-oxobutanoate hydroxymethyltransferase (ketopantoate hydroxymethyltransferase)

Gene Start:
429655

Gene Stop:
430443

Gene Length:
789

Molecular Weight*:
27711

pI*:
6.50

Net Charge*:
-1.84

EC:
2.1.2.11  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pantothenate  

Pathway: pathway table
One carbon pool by folate
Pantothenate and CoA biosynthesis

Secondary Evidence:
Jones,C.E., Brook,J.M., Buck,D., Abell,C. and Smith,A.G. 1993. Cloning and sequencing of the Escherichia coli panB gene, which
encodes ketopantoate hydroxymethyltransferase, and overexpression
of the enzyme. J. Bacteriol. 175 (7): 2125-2130. Medline: 93209959.


Comment:
Oklahoma ID: NGO.436

For other 'pan' genes, see NG0437 (panC), NG0620 (panD).

Blast Summary:  PSI-Blast Search
NG0436 is orthologous to AL162755, N.meningitidis (Z2491) putative 3-methyl-2-oxobutanoate hydroxymethyltransferase protein: residues 1-263 are 98% similar to residues 1-263 of NG0436.

Numerous significant hits to 3-methyl-2-oxobutanoate hydroxymethyltransferase (ketopantoate hydroxymethyltransferase) in gapped BLAST; e.g. residues 4-265 are 57% similar to emb|CAA10222.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase of Pseudomonas fluorescens, residues 3-261 are 54% similar to dbj|BAB33561.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase of Escherichia coli O157:H7, residues 2-262 are 51% similar to gb|AAF93759.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase ofVibrio cholerae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0413
COG name: Ketopantoate hydroxymethyltransferase
Functional Class:  H
The phylogenetic pattern of COG0413 is ---kyqvcebr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003700 (Ketopantoate hydroxymethyltransferase) with a combined E-value of 1.2e-140.
    IPB003700A    23-58
    IPB003700B    60-88
    IPB003700C    111-154
    IPB003700D    176-218
    IPB003700E    225-261


ProDom Summary:  Protein Domain Search
Residues 2-261 are 50% similar to a (3-METHYL-2-OXOBUTANOATE HYDROXYMETHYLTRANSFERASE) protein domain (PD007676) which is seen in Q9ZEP8_PSEFL.



Paralogs:  Local Blast Search


NG0436 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 258 (E-value = 1.7e-139) place NG0436 in the Pantoate_transf family which is described as Ketopantoate hydroxymethyltransferase (PF02548)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
33

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MITVNTLQKMKAAGEKIVMLTAYESSFAALMDDAGVDVLLVGDSLGMAVQ
GRQSTLPVSLRDMCYHTECVARGAKNAMIVSDLPFGAYQQSKEQAFAAAA
ELMAAGAHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYK
VQGRGGKAQALLNDAKAHDEAGAAVVLMECVPAELAKKVTETVSCPTIGI
GAGADCDGQVLVMHDMLGIFPGKTAKFVKNFMRGQSSIQAAVRAYVAEVK
AKTFPAAEHIFAD

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTACTGTGAACACACTGCAAAAAATGAAGGCGGCCGGCGAGAAAAT
CGTTATGCTGACCGCTTACGAATCCAGTTTTGCCGCGCTGATGGACGATG
CCGGCGTGGATGTGCTGTTGGTCGGGGATTCTTTGGGAATGGCGGTTCAG
GGGCGACAGTCGACGCTGCCGGTCAGCCTGCGCGATATGTGCTATCACAC
CGAATGTGTAGCACGCGGTGCAAAAAATGCGATGATTGTCAGCGATTTGC
CGTTTGGTGCATATCAGCAGAGTAAGGAGCAGGCGTTTGCCGCCGCCGCC
GAACTGATGGCTGCCGGCGCGCATATGGTCAAACTCGAAGGCGGCGTGTG
GATGGCGGAAACGACTGAATTTCTGCAAATGCGCGGAATTCCGGTCTGTG
CCCACATCGGTCTGACCCCGCAATCCGTGTTTGCCTTCGGCGGATATAAA
GTTCAGGGGCGCGGCGGCAAGGCGCAGGCGTTGCTTAACGATGCCAAGGC
GCATGATGAAGCCGGAGCTGCCGTCGTACTGATGGAATGCGTGCCGGCGG
AACTGGCAAAAAAGGTAACTGAAACTGTTTCCTGTCCGACCATCGGCATC
GGGGCGGGCGCGGATTGCGACGGTCAGGTTTTGGTGATGCACGATATGCT
CGGTATTTTCCCGGGCAAAACGGCGAAATTCGTCAAAAACTTTATGCGCG
GGCAAAGCAGCATCCAGGCTGCGGTTCGGGCGTATGTTGCCGAAGTCAAA
GCCAAAACCTTCCCTGCTGCGGAACATATTTTTGCAGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy