Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0358 IGR0356 IGR0363.1 IGR0355 IGR0360 IGR0353 IGR0354 IGR0359 IGR0357 IGR0364 IGR0361 IGR0363 IGR0362 NG0429 NG0431 NG0428 NG0430 NG0422 NG0432 dcd, - NG0421 rdgC, - NG0425 NG0427 rdgC, - NG0423 hisS, - NG0426 NG0424 NG0420 NG0433 NG0429 NG0431 NG0428 NG0430 NG0422 NG0432 dcd, - NG0421 rdgC, - NG0425 NG0427 rdgC, - NG0423 hisS, - NG0426 NG0424 NG0420 NG0433 NG0429 NG0430 NG0422 NG0432 dcd, - NG0421 rdgC, - NG0425 NG0427 rdgC, - NG0423 hisS, - NG0426 NG0424 NG0431 NG0428 NG0420 NG0433
* Calculated from Protein Sequence

Gene ID: NG0426

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisS  

Definition:
histidyl-tRNA synthetase (histidine--tRNA ligase)

Gene Start:
422677

Gene Stop:
421385

Gene Length:
1293

Molecular Weight*:
48330

pI*:
5.40

Net Charge*:
-7.42

EC:
6.1.1.21  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Histidine metabolism

Secondary Evidence:
Freedman,R., Gibson,B., Donovan,D., Biemann,K., Eisenbeis,S.,
Parker,J. and Schimmel,P. 1985. Primary structure of histidine-tRNA synthetase and characterization of hisS transcripts. J. Biol. Chem. 260 (18): 10063-10068. Medline: 85261421.
Eisenbeis,S.J. and Parker,J. 1982. The nucleotide sequence of the promoter region of hisS, the structural gene for histidyl-tRNA synthetase. Gene 18 (2): 107-114. Medline: 83028525.


Comment:
Oklahoma ID: NGO.426c

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0397 (HisZ), NG0185 (his2), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
NG0426 is orthologously related to AE002438, Neisseria meningitidis, strain MC58, a histidyl-tRNA synthetase protein: residues 1-431 are 96% similar to residues 1-431 of NG0426. NG0426 is orthologously related to G81871 Neisseria meningitidis, group A strain Z2491, a probable histidine--tRNA ligase protein: residues 1-431 are 96% similar to residues 1-431 of NG0426.

Numerous significant hits to histidyl-tRNA synthetase (histidine--tRNA ligase) proteins in gapped BLAST; e.g. residues 1-425 are 54% similar to gb|AAF93925.1| histidyl-tRNA synthetase of Vibrio cholerae, residues 1-420 are 54% similar to 7388277 histidyl-tRNA synthetase (histidine--tRNA ligase) (HISRS) of Salmonella typhimurium, residues 1-426 are 50% similar to gb|AAC22027.1| histidyl-tRNA synthetase of Haemophilus influenzae
Rd.


COGS Summary:  COGS Search
BeTs to 17 clades of COG0124
COG name: Histidyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0124 is amtkYQVCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 313-426 are 37% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000606) which is seen in SYH_HAEIN.

Residues 208-312 are 62% similar to a (SYNTHETASE AMINOACYL-TRNA HISTIDYL-TRNA) protein domain (PD001912) which is seen in SYH_HAEIN.

Residues 6-175 are 58% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000380) which is seen in SYH_ECOLI.



Paralogs:  Local Blast Search


NG0426 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 167 (E-value = 2.5e-32) place NG0426 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 337 to 428 (E-value = 9.9e-10) place NG0426 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1KMM|1KMM-A HISTIDYL-TRNA SYNTHETASE COMPLEXED WITH 431.0 0e+00
pdb|1HTT|1HTT-A HISTIDYL-TRNA SYNTHETASE 429.0 0e+00
pdb|1QE0|1QE0-A CRYSTAL STRUCTURE OF APO S. AUREUS HISTIDYL-TRNA308.0 1e-84
pdb|1ADJ|1ADJ-A HIST

Gene Protein Sequence:
MAQKIQSVKGMNDLLPVGQKDFKLTAVFWQAFEDTVNRWTRAYGYQQIRT
PIVEQTGLFVRSIGEETDVVGKEMYTFSDSNDSLSLSLRPEGTASCLRAV
VEHNLLYNSPQKLWYMGPMFRRERPQKGRYRQFHQVGIEALGFEGPDIDA
EIIAMSADLWEKLGIREYLTLEINSLGNREERAAHRAALVEYLTRYEAQL
DEDSKRRLKTNPLRVLDTKNPDLQEICNAAPRLVDYLGEASQNHYARFKA
MLDGLGIQYIENSRLVRGLDYYNQTVFEWTTDKLGAQATVCGGGRYDGLI
EELGGKPAPSIGFAMGIERLLLLVSEYGSLEVNAAPDVYAMHQGEGADLQ
VMKYAQALRAQGFNVIQHSGYQSLKAQMKKADNSGARFALIVAQDELADG
TVTLKDMNGAHGQQTVSATDLTDTLQQWKNA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACAAAAAATCCAATCCGTCAAAGGCATGAACGACCTTCTGCCTGT
CGGGCAAAAAGATTTCAAACTCACGGCTGTGTTTTGGCAGGCGTTTGAGG
ATACGGTAAACCGTTGGACGCGAGCTTACGGTTATCAGCAAATCCGTACG
CCGATTGTCGAGCAAACCGGTTTGTTTGTCCGCTCCATCGGCGAGGAAAC
CGATGTAGTCGGCAAGGAAATGTACACCTTCTCCGATTCAAACGATTCTT
TGAGTTTGAGCCTGCGTCCCGAAGGTACGGCCTCTTGTCTGCGTGCGGTG
GTCGAACACAACCTTCTGTACAACAGCCCGCAAAAGCTGTGGTATATGGG
GCCGATGTTCCGCCGCGAGCGTCCGCAAAAAGGACGCTACCGCCAATTTC
ATCAGGTCGGTATCGAGGCTTTGGGTTTTGAAGGGCCGGATATTGATGCG
GAAATCATCGCAATGTCTGCCGACTTGTGGGAAAAATTGGGTATTCGCGA
ATACCTGACTTTGGAAATCAACAGCTTGGGCAACCGTGAGGAACGCGCGG
CACACCGTGCGGCATTGGTTGAATATCTGACCCGCTATGAAGCGCAACTG
GACGAAGACAGCAAACGCCGTCTGAAAACCAATCCTTTGCGCGTTTTGGA
TACGAAAAACCCTGATTTGCAGGAAATCTGCAATGCCGCGCCGCGTTTGG
TAGATTACTTGGGCGAGGCTTCGCAAAACCACTATGCACGCTTCAAGGCG
ATGTTGGACGGTTTGGGTATTCAATATATTGAAAATTCGCGCTTGGTTCG
CGGTTTGGATTATTACAATCAGACGGTTTTTGAGTGGACGACCGACAAAC
TCGGCGCGCAGGCGACTGTGTGCGGCGGCGGACGTTACGACGGTTTGATT
GAAGAACTCGGCGGCAAGCCTGCGCCGTCCATCGGCTTTGCGATGGGCAT
CGAACGGCTGCTGCTTTTGGTGAGCGAATACGGTTCGCTGGAAGTGAACG
CCGCGCCTGATGTCTATGCAATGCACCAAGGCGAAGGGGCGGACTTGCAG
GTGATGAAATACGCACAAGCCTTGCGCGCGCAAGGTTTCAATGTAATACA
GCATTCCGGCTATCAAAGCCTGAAGGCGCAAATGAAAAAAGCCGACAACA
GCGGCGCGCGCTTTGCCCTGATTGTCGCGCAAGACGAACTGGCGGACGGT
ACCGTTACGCTCAAAGACATGAACGGCGCACACGGTCAGCAAACCGTTTC
CGCCACCGATTTGACAGATACTTTACAACAATGGAAGAACGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy