Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0358 IGR0351 IGR0356 IGR0355 IGR0353 IGR0354 IGR0352 IGR0350 IGR0352.1 IGR0357 IGR0349 NG0422 NG0418 dcd, - NG0421 NG0419 rdgC, - NG0425 rdgC, - NG0423 NG0417 hisS, - NG0426 NG0424 NG0416 NG0420 pcnB, - NG0415 NG0422 NG0418 dcd, - NG0421 NG0419 rdgC, - NG0425 rdgC, - NG0423 NG0417 hisS, - NG0426 NG0424 NG0416 NG0420 pcnB, - NG0415 NG0422 NG0418 dcd, - NG0421 NG0419 rdgC, - NG0425 rdgC, - NG0423 NG0417 hisS, - NG0426 NG0424 NG0416 NG0420 pcnB, - NG0415
* Calculated from Protein Sequence

Gene ID: NG0421

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dcd  

Definition:
deoxycytidine triphosphate deaminase

Gene Start:
417678

Gene Stop:
417115

Gene Length:
564

Molecular Weight*:
21266

pI*:
4.70

Net Charge*:
-5.28

EC:
3.5.4.13  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Wang,L. and Weiss,B.
dcd (dCTP deaminase) gene of Escherichia coli: mapping, cloning,
sequencing, and identification as a locus of suppressors of lethal
dut (dUTPase) mutations
J. Bacteriol. 174 (17), 5647-5653 (1992)
M:92380941


Comment:
Oklahoma ID: NGO.421c

Blast Summary:  PSI-Blast Search
NG0421 is orthologously related to AE002438, Neisseria meningitidis, strain MC58, a putative deoxycytidine triphosphate deaminase protein: residues 1-188 are 98% similar to residues 1-188 of NG0421.

Numerous significant hits to deoxycytidine triphosphate deaminase proteins in gapped BLAST; e.g. residues 1-187 are 78% similar to gb|AAF83572.1|AE003917_6 deoxycytidine triphosphate deaminase of Xylella fastidiosa, residues 1-188 are 77% similar to gb|AAG06868.1|AE004769_1 probable deoxycytidine triphosphate deaminase of Pseudomonas aeruginosa, residues 1-186 are 66% similar to gb|AAC67629.1| deoxycytidine triphosphate deaminase family protein of Chlamydia trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0717
COG name: Deoxycytidine deaminase
Functional Class:  F
The phylogenetic pattern of COG0717 is aMTk-q-ce-rhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003232 (dCTP Deaminase) with a combined E-value of 1.1e-60.
    IPB003232A    2-10
    IPB003232B    44-56
    IPB003232C    86-124
    IPB003232D    127-140
    IPB003232E    145-173
***** IPB001428 (dUTPase) with a combined E-value of 2.3e-13.
    IPB001428A    37-47
    IPB001428B    118-136
    IPB001428C    150-161
    IPB001428D    173-182


ProDom Summary:  Protein Domain Search
Residues 12-177 are 67% similar to a (DEAMINASE DEOXYCYTIDINE TRIPHOSPHATE) protein domain (PD004900) which is seen in O84042_CHLTR.



Paralogs:  Local Blast Search


NG0421 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGQRIISYGTSSYGYDIRCA
NEFKIFTNINSTIVDPKNFDPKNFVTVEDDCCIIPPNSFALARTVEYFRI
PRNVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYA
GEGVAQVLFFESDEVCETSYKDRNGKYMGQTGVTLPKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCATCAAGTCCGACAAATGGATACGCCGAATGAGCGAAGAATTCGG
CATGATTGATCCCTTCGAGCCGAACCAAATCAAAGAAGCCGACGGACAGC
GCATCATCTCCTACGGTACGTCCAGCTACGGCTACGATATCCGCTGCGCC
AATGAATTTAAAATTTTTACCAACATCAACAGCACCATCGTCGATCCCAA
AAACTTCGACCCGAAAAATTTCGTTACCGTCGAAGACGACTGCTGCATCA
TCCCGCCCAATTCCTTCGCACTGGCGCGCACGGTCGAATATTTCCGCATT
CCGCGCAACGTCCTGACCGTCTGTTTGGGCAAATCCACCTACGCCCGCTG
CGGCATCATCGTCAACGTTACCCCGTTCGAGCCGGAATGGGAAGGCTACG
TTACCCTCGAGTTTTCCAACACCACCCCCCTGCCCGCCAAAATCTACGCA
GGCGAAGGCGTGGCGCAAGTCCTCTTCTTCGAGAGCGACGAAGTGTGTGA
AACTTCATACAAAGACCGCAACGGCAAATACATGGGACAAACCGGCGTAA
CCCTGCCCAAAGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy