Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0351 IGR0346 IGR0353 IGR0347 IGR0354 IGR0352 IGR0350 IGR0352.1 IGR0345 IGR0349 IGR0348 NG0418 dcd, - NG0421 NG0419 NG0417 tldE,pmbA, - NG0411 NG0416 NG0412 NG0413 NG0420 pcnB, - NG0415 recJ, - NG0414 NG0418 dcd, - NG0421 NG0419 NG0417 tldE,pmbA, - NG0411 NG0416 NG0412 NG0413 NG0420 pcnB, - NG0415 recJ, - NG0414 NG0418 dcd, - NG0421 NG0419 NG0417 tldE,pmbA, - NG0411 NG0416 NG0412 NG0413 NG0420 pcnB, - NG0415 recJ, - NG0414
* Calculated from Protein Sequence

Gene ID: NG0415

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pcnB  

Definition:
polynucleotide adenylyltransferase (poly(A) polymerase)

Gene Start:
412064

Gene Stop:
413419

Gene Length:
1356

Molecular Weight*:
51396

pI*:
10.60

Net Charge*:
20.79

EC:
2.7.7.19  

Functional Class:
Transcription; Transcription factors  

Pathway: pathway table

Secondary Evidence:
Liu,J.D. and Parkinson,J.S. 1989.
Genetics and sequence analysis of the pcnB locus, an Escherichia coli gene involved in plasmid copy number control.
J. Bacteriol. 171 (3): 1254-1261.
Medline: 89155419.

Cao,G.J. and Sarkar,N. 1992.
Identification of the gene for an Escherichia coli poly(A) polymerase.
Proc. Natl. Acad. Sci. U.S.A. 89 (21): 10380-10384.
Medline: 93066242.

Comment:
Oklahoma ID: NGO.415

Blast Summary:  PSI-Blast Search
NG0415 is orthologously related to AL162755, Neisseria meningitidis, strain Z2491, a putative poly(A) polymerase protein: residues 1-453 are 97% similar to residues 1-452 of NG0415.

Numerous significant hits in gapped BLAST; e.g. residues 1-419 are 42% similar to gb|AAG08113.1|AE004886_5 poly(A) polymerase of Pseudomonas aeruginosa, residues 1-426 are 43% similar to 365036 polynucleotide adenylyltransferase of Pseudomonas putida, residues 7-442 are 39% similar to gb|AAF93761.1| polyA polymerase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0617
COG name: tRNA nucleotidyltransferase/poly(A) polymerase
Functional Class:  J
The phylogenetic pattern of COG0617 is ----yQvCEbrHuj--oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002646 (Poly A polymerase family) with a combined E-value of 2.2e-41.
    IPB002646A    56-75
    IPB002646B    138-153
    IPB002646C    178-204
    IPB002646D    226-239


ProDom Summary:  Protein Domain Search
Residues 28-212 are 56% similar to a (POLYMERASE TRANSFERASE POLYA) protein domain (PD003898) which is seen in O87789_PSEPU.

Residues 229-409 are 35% similar to a (POLYMERASE POLYA TRANSFERASE PAP MRNA PROCESSING) protein domain (PD036398) which is seen in O87789_PSEPU.



Paralogs:  Local Blast Search


NG0415 is paralogously related to NG0763 (tRNA nucleotidyltransferase (tRNA adenylyltransferase) (tRNA CCA-pyrophosphorylase) (CCA-adding enzyme)) (9e-18).


Pfam Summary:  Pfam Search
Residues 113 to 269 (E-value = 3.3e-51) place NG0415 in the PolyA_pol family which is described as Poly A polymerase family (PF01743)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
360  
452

PDB Hit:
pdb|1MIV|1MIV-A CRYSTAL STRUCTURE OF BACILLUS STEAROTHERMOPHILUS121.0 3e-28

Gene Protein Sequence:
MLKKWLNKMLPSGRSSKKAESKTVIPAERHNISAEMLSFAAENVIRRLKG
AGFQAYVVGGAVRDLLLGIEPKDFDVATDATPEQVHKLFRRSRIIGRRFQ
IVHVMNGAEIIEVTTFRGGAKVHQNAHGRIMKDNTYGSIEEDAMRRDFTC
NALYYDPEKEEILDFHNGIADVAARRLVMIGNAAERYQEDPVRILRAIRL
SGKLGFELSEETAAPIAESICRLKHEPVARLFDEIMKLLFSGHARECLKR
LNGFDIPDIHPLLNALRVSDGIAGKMTALALKNTDERLRADKSVSVGFVL
AALMWPELDRHWKSNLQQGLKPTPALSDAINTMRETVERGWGVPQRFSAT
MREIWMFQPQFENRKGARPHKLFAQARFRAAYDFLLLRAETGNADRALAE
WWTAFQTASAEQRTEMTKNEAAARHEKNEGQAKKRRRRRRKPKPKVVGTD
WE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGAAAAAATGGTTGAATAAGATGCTGCCTTCCGGTCGGAGCAGTAA
AAAAGCGGAAAGTAAAACGGTCATTCCTGCCGAAAGACACAACATCAGTG
CCGAAATGTTGAGCTTTGCCGCCGAAAACGTCATACGCCGCCTGAAAGGG
GCGGGGTTTCAGGCTTATGTGGTCGGCGGTGCGGTCAGAGACCTGCTGCT
CGGCATCGAACCCAAAGATTTCGATGTCGCAACTGATGCCACGCCCGAAC
AGGTGCACAAACTCTTCCGCCGCAGCCGCATCATCGGCAGGCGTTTTCAG
ATTGTCCATGTGATGAACGGTGCGGAGATTATCGAAGTAACGACGTTTCG
CGGCGGTGCGAAGGTTCATCAGAACGCGCACGGCAGAATCATGAAGGACA
ACACCTACGGCAGCATCGAAGAAGATGCGATGCGGCGCGATTTTACCTGC
AATGCCTTGTATTACGATCCTGAAAAAGAAGAGATTTTGGATTTCCACAA
CGGGATTGCCGATGTTGCCGCCCGCAGGCTGGTTATGATTGGTAATGCCG
CCGAACGCTATCAGGAAGACCCTGTCAGGATTTTGCGCGCCATCCGCCTG
TCGGGCAAATTGGGCTTTGAGCTGTCGGAAGAAACCGCCGCACCGATTGC
CGAATCGATATGCCGTCTGAAGCACGAACCTGTGGCAAGGCTGTTCGACG
AAATCATGAAACTGCTGTTTTCAGGGCACGCGCGCGAGTGTCTGAAACGT
TTGAACGGATTTGACATACCGGACATCCATCCGCTGCTCAATGCTTTGCG
CGTTTCAGACGGCATCGCCGGAAAAATGACGGCGCTTGCCCTGAAAAATA
CCGATGAGCGGCTGCGTGCCGACAAATCGGTTTCGGTCGGTTTCGTACTG
GCGGCCCTGATGTGGCCAGAGTTGGACCGCCATTGGAAAAGCAATCTGCA
ACAGGGTTTGAAACCTACGCCCGCCCTGTCCGATGCAATCAATACGATGC
GCGAAACCGTCGAACGCGGTTGGGGCGTACCGCAACGCTTTTCCGCCACG
ATGCGTGAAATTTGGATGTTCCAGCCGCAGTTTGAAAACCGCAAAGGCGC
ACGTCCGCACAAACTGTTTGCACAGGCGCGTTTCCGTGCCGCCTATGATT
TCCTGCTCTTGCGCGCCGAAACCGGCAATGCGGACCGCGCACTTGCCGAG
TGGTGGACGGCGTTTCAGACGGCATCGGCGGAACAGCGGACGGAAATGAC
CAAAAACGAGGCCGCCGCCCGGCACGAAAAAAACGAAGGACAGGCGAAAA
AACGCCGCCGTCGCAGGCGCAAACCCAAGCCGAAGGTTGTGGGAACGGAT
TGGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy