Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0342 IGR0351 IGR0346 IGR0347 IGR0352 IGR0350 IGR0345 IGR0349 IGR0343 IGR0344 IGR0348 NG0409 NG0418 NG0419 NG0417 tldE,pmbA, - NG0411 clpA, - NG0408 cspA, - NG0410 NG0416 NG0412 NG0413 pcnB, - NG0415 recJ, - NG0414 NG0409 NG0418 NG0419 NG0417 tldE,pmbA, - NG0411 clpA, - NG0408 cspA, - NG0410 NG0416 NG0412 NG0413 pcnB, - NG0415 recJ, - NG0414 NG0419 NG0417 tldE,pmbA, - NG0411 clpA, - NG0408 NG0409 NG0418 cspA, - NG0410 NG0416 NG0412 NG0413 pcnB, - NG0415 recJ, - NG0414
* Calculated from Protein Sequence

Gene ID: NG0414

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recJ  

Definition:
single-stranded-DNA-specific exonuclease

Gene Start:
410006

Gene Stop:
411703

Gene Length:
1698

Molecular Weight*:
61917

pI*:
5.30

Net Charge*:
-13.34

EC:
3.1.-.-  

Functional Class:
Replication; Degradation of DNA  
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Lovett,S.T. and Kolodner,R.D. 1989. Identification and purification of a single-stranded-DNA-specific exonuclease encoded by the recJ gene of Escherichia coli. Proc. Natl. Acad. Sci. U.S.A. 86 (8): 2627-2631. Medline: 89202382.

Lovett,S.T. and Kolodner,R.D. 1991. Nucleotide sequence of the Escherichia coli recJ chromosomal region and construction of recJ-overexpression plasmids. J. Bacteriol. 173 (1): 353-364. Medline: 91100304.


Comment:
Oklahoma ID: NGO.414

For other 'rec' genes, see NG0318 (recN), NG0370 (recB), NG0117 (recG), NG0741 (recA), NG0767 (recR), NG0771 (recD), NG1053 (recX), NG1369 (recC), NG1509 (recO), NG1722 (recQ).

Blast Summary:  PSI-Blast Search
NG0414 is 99% identical to a previously sequenced N.gonorrhoeae protein, RecJ, in GenBank, 7453624.

NG0414 is orthologously related to AE002437, Neisseria meningitidis, strain MC58, a single-stranded-DNA-specific exonuclease (RecJ) protein: residues 1-566 are 96% similar to residues 1-566 of NG0414.

Numerous significant hits to single-stranded DNA exonuclease proteins in gapped BLAST; e.g. residues 25-560 are 52% similar to gb|AAG07112.1|AE004791_9 single-stranded-DNA-specific exonuclease RecJ of Pseudomonas aeruginosa, residues 19-561 are 49% similar to dbj|BAB37187.1| ssDNA exonuclease RecJ of Escherichia coli O157:H7, residues 3-565 are 46% similar to gb|AAF95560.1| single-stranded-DNA-specific exonuclease RecJ of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0608
COG name: Single-stranded DNA-specific exonuclease
Functional Class:  L
The phylogenetic pattern of COG0608 is AMTk-qvceB-hUJ--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001667 (DHH family) with a combined E-value of 4.3e-12.
    IPB001667A    80-93
    IPB001667B    156-163
    IPB001667C    421-429


ProDom Summary:  Protein Domain Search
Residues 223-332 are 68% similar to a (EXONUCLEASE RECJ) protein domain (PD007759) which is seen in RECJ_ECOLI.

Residues 59-206 are 54% similar to a (PROTEIN EXONUCLEASE RECJ) protein domain (PD003186) which is seen in RECJ_ECOLI.

Residues 353-518 are 44% similar to a (EXONUCLEASE RECJ PROTEIN) protein domain (PD009926) which is seen in RECJ_HAEIN.



Paralogs:  Local Blast Search


NG0414 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 68 to 232 (E-value = 1.1e-46) place NG0414 in the DHH family which is described as DHH family (PF01368)
Residues 377 to 446 (E-value = 2e-18) place NG0414 in the DHHA1 family which is described as DHHA1 domain (PF02272)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
176
transmembrane  
187  
203
transmembrane  
220  
236
coil-coil  
306  
333

PDB Hit:
pdb|1IR6|1IR6-A CRYSTAL STRUCTURE OF EXONUCLEASE RECJ BOUND TO 196.0 9e-51

Gene Protein Sequence:
MSVKIQTRPVNTDVFNHLLAAGADPLIARLCASRGVQSPAELDDKLASLL
PYQSLTNCEAAAGRLADAVERKEKILIVADYDADGATACAVGLDGLAAMG
AKVDFLVPNRFEHGYGLTPELAEIAAAQGVDLLITVDNGIASIAGVARAQ
ALGLDVIVTDHHLPADTVPDCIIVNPNQKGCGFPSKSLAGVGVIFYVLTA
LRAELRRRNYFSDGIKEPNLGGLLDLVALGTVADVVPLDHNNRILVSQGL
KRMRSGKMRPGIRALFEVARRDWRKAQPFDMGFALGPRINAAGRLDDMSV
GIACLLARDDSEAQELAARLNNLNIERREIEQSMLRDALNAFPETLPSGQ
TTLVAYRDDFHQGVVGIVASRLKDRFYRPTIVFAPADNGEVRGSGRSIPN
LHLRDALDLVSKRHPDLILKFGGHAMAAGLSILEHNIPAFQTAFEEAVRE
MVCEDDLSQTYITDGSLPACDITLEQAQNLACHVWGQGFAPPSFTDEFHV
VRQQPLGAEGKHKKAWLQKDGCEFEAMFWRCSEDIPEYIRTVYRPVANEW
RNNLELQLYIDYWEAA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGTCAAAATCCAAACCCGCCCCGTCAATACCGACGTTTTCAATCA
TTTGCTCGCCGCCGGCGCCGATCCTTTAATCGCCCGGCTTTGTGCCTCGC
GCGGTGTGCAAAGTCCTGCCGAGTTGGACGACAAACTCGCTTCCCTCCTG
CCTTATCAATCGCTGACGAATTGCGAAGCCGCCGCCGGCCGTTTGGCGGA
TGCGGTTGAACGCAAGGAAAAAATCCTGATTGTCGCCGACTATGATGCCG
ACGGCGCGACCGCGTGTGCCGTCGGTTTGGACGGTTTGGCGGCGATGGGC
GCGAAAGTGGATTTCCTCGTGCCCAACCGCTTTGAGCACGGCTACGGCTT
AACGCCCGAACTCGCCGAAATCGCCGCCGCGCAAGGCGTGGATTTGCTGA
TTACGGTGGATAACGGCATTGCCAGTATTGCAGGCGTGGCGCGCGCGCAG
GCTCTGGGTTTGGATGTCATCGTTACCGACCACCATTTGCCAGCCGATAC
CGTACCCGACTGCATCATCGTCAATCCGAACCAAAAAGGCTGCGGTTTTC
CAAGCAAAAGCTTGGCGGGCGTGGGCGTGATTTTTTATGTGTTGACGGCG
TTGCGTGCCGAACTGCGCCGCCGCAATTATTTTTCAGACGGCATCAAAGA
GCCGAATCTGGGCGGCCTTTTGGATTTGGTCGCACTCGGTACCGTCGCCG
ATGTCGTCCCCCTCGACCACAACAACCGCATCCTCGTGTCGCAAGGTTTG
AAACGGATGCGTTCGGGCAAAATGCGCCCCGGCATCCGCGCCTTGTTTGA
AGTGGCGCGGCGCGATTGGCGCAAGGCTCAGCCGTTTGATATGGGCTTTG
CGTTGGGCCCGCGCATCAACGCCGCCGGACGGCTGGACGATATGTCGGTC
GGCATCGCCTGCCTGTTGGCGCGAGATGATTCCGAAGCGCAGGAACTGGC
GGCTCGGTTAAACAACCTCAATATCGAACGCCGCGAAATCGAGCAGTCTA
TGCTGCGAGACGCGTTGAACGCCTTTCCCGAAACCCTGCCTTCAGGTCAG
ACGACTTTGGTGGCGTATCGCGACGACTTCCATCAAGGCGTGGTCGGCAT
TGTTGCCAGCCGCCTCAAAGACCGTTTTTACCGTCCGACCATCGTGTTTG
CGCCGGCGGACAACGGCGAAGTGCGCGGTTCGGGACGCTCCATTCCCAAT
CTGCACTTGCGCGATGCTTTGGACTTGGTGTCCAAACGCCATCCCGATTT
GATTTTGAAATTCGGCGGACACGCGATGGCGGCGGGTTTAAGCATACTTG
AACACAATATTCCCGCGTTTCAGACGGCCTTTGAAGAAGCCGTGCGTGAG
ATGGTGTGCGAAGACGATTTGTCGCAAACCTATATTACTGACGGCAGCCT
GCCCGCCTGCGACATCACGTTGGAACAGGCGCAAAACCTCGCCTGCCACG
TTTGGGGGCAGGGCTTTGCGCCGCCGAGCTTTACCGACGAGTTCCACGTC
GTTCGCCAGCAGCCTTTGGGCGCGGAAGGCAAACACAAAAAAGCGTGGTT
GCAAAAAGACGGCTGCGAATTTGAAGCGATGTTCTGGCGTTGCAGCGAAG
ACATTCCCGAATACATCCGCACGGTGTACCGCCCCGTTGCCAACGAATGG
CGCAACAACCTCGAATTGCAGCTTTATATCGACTACTGGGAAGCGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy