Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0342 IGR0341 IGR0339 IGR0340 IGR0343 IGR0344 IGR0340.1 NG0409 tldE,pmbA, - NG0411 clpA, - NG0408 cspA, - NG0410 hsdS, - NG0406 dinD, - NG0405 hsdM, - NG0404 hsdR, - NG0407 NG0409 tldE,pmbA, - NG0411 clpA, - NG0408 cspA, - NG0410 hsdS, - NG0406 dinD, - NG0405 hsdM, - NG0404 hsdR, - NG0407 Type: tandem, Name:  - 18 NG0409 tldE,pmbA, - NG0411 clpA, - NG0408 cspA, - NG0410 hsdS, - NG0406 dinD, - NG0405 hsdM, - NG0404 hsdR, - NG0407
* Calculated from Protein Sequence

Gene ID: NG0407

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdR  

Definition:
type I restriction enzyme EcoR124II R protein (type I site-specific deoxyribonuclease EcoR124/3 chain)

Gene Start:
400706

Gene Stop:
403801

Gene Length:
3096

Molecular Weight*:
118497

pI*:
6.20

Net Charge*:
-10.27

EC:
3.1.21.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Price,C., Lingner,J., Bickle,T.A., Firman,K. and Glover,S.W. 1989. Basis for changes in DNA recognition by the EcoR124 and EcoR124/3 type I DNA restriction and modification enzymes. J. Mol. Biol. 205 (1): 115-125. Medline: 89178628.


Comment:
Oklahoma ID: NGO.407

For other 'hsd' genes, see NG0404 (hsdM), NG0697 (hsdR), NG0699 (hsdS), NG0702 (hsdM).

Blast Summary:  PSI-Blast Search
NG0407 is orthologously relqated to AE002436, Neisseria meningitidis, strain MC58, a putative type I restriction enzyme EcoR124II R protein: residues 6-921 are 97% similar to residues 117-1032 of NG0407.

Numerous significant hits in gapped BLAST; e.g. residues 1-1017 are 74% similar to pir||S02168 type I site-specific deoxyribonuclease EcoR124/3 chain of Escherichia coli plasmid R124/3, residues 25-1028 are 43% similar to gb|AAF85510.1|AE004079_1 type I restriction-modification system endonuclease of Xylella fastidiosa, residues 134-1032 are 44% similar to gb|AAD07892.1| type I restriction enzyme R protein of Helicobacter pylori 26695.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0610
COG name: Restriction enzymes type I helicase subunits and related helicases
Functional Class:  L
The phylogenetic pattern of COG0610 is aMt-----e--HUJ-P-----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 543-734 are 79% similar to a (RESTRICTION TYPE ENZYME PROTEIN) protein domain (PD003073) which is seen in T1R1_ECOLI.

Residues 475-541 are 77% similar to a (TYPE I RESTRICTION ENZYME) protein domain (PD209459) which is seen in T1R1_ECOLI.

Residues 134-217 are 89% similar to a (RESTRICTION TYPE ENZYME PROTEIN) protein domain (PD003712) which is seen in PRRD_ECOLI.

Residues 227-422 are 82% similar to a (RESTRICTION TYPE ENZYME I) protein domain (PD003184) which is seen in T1R1_ECOLI.

Residues 432-474 are 95% similar to a (RESTRICTION PROTEIN TYPE I) protein domain (PD041102) which is seen in T1R1_ECOLI.

Residues 745-1017 are 62% similar to a (RESTRICTION TYPE ENZYME I PROTEIN R HSDR SUBUNIT) protein domain (PD041103) which is seen in T1R1_ECOLI.

Residues 1-132 are 61% similar to a (TYPE I RESTRICTION ENZYME) protein domain (PD037177) which is seen in T1R1_ECOLI.

Residues 377-477 are 45% similar to a (PROTEIN ORF PUTATIVE KINASE) protein domain (PD000146) which is seen in Q50357_MYCPU.



Paralogs:  Local Blast Search


NG0407 is paralogously related to NG0697 (type I restriction enzyme R protein HsdR) (4e-30).


Pfam Summary:  Pfam Search
Residues 29 to 220 (E-value = 1.5e-53) place NG0407 in the HSDR_N family which is described as Type I restriction enzyme R protein N terminus (HSDR_N) (PF04313)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
33  
74
transmembrane  
646  
662

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNLETKPIAETPNFIVLDQYEKIEQSGSYQSENRLEAELIADLQNQGYEY
RKDLNSQSRLLENLRAQLQRLNDVAFSDGEWARFLTEYLDRPAENITDKT
RKIHDDHIYDFAFDDGRLKNIYLLDKKNLARNHVQLINQFEQTGTHANRY
DVTVLVNGLPLVQIELKKRGVAVREAFNQVHRYSKESFNSGNSLFKFLQI
FVISNGTDTRYFANTTKRDKNSFDFTMNWARSDNHPIKDLKDFTATFLQK
SVLLSVLLHYSVFDANDTLLIMRPYQIAAAERILWKINSSAQAKNWSGPE
SGGYVWHTTGSGKTLTGFKAARLATESAFIDKVFFVVDRKDLDYQTMKEY
QRFSPDSVNGSESTAGLKRNLEKDGNKIIVTTIQKLNNLMKSEDNLPVYH
RQVVFIFDECHRSQFGEAQKNLKKKFKKFCQFGFTGTPIFPENALGAETT
AGVFGRELHSYVITDAIRDEKVLKFKVDYNDVRPQFKAVEAEQDEKELSA
AENRQALLHPERIREITQYILSRFRQKTHRLNAGGKGFNAMFAVSSVDAA
KCYYEAFKTQQAGSLHPLKTATIFSFAANEEQNAVGEIVDETFEPEAMDS
SAKEFLQAAINDYNACFKTNFGTDSKAFQNYYRDLAKRVKNREVDLLIVV
GMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFGNIVCFR
DLEQATIDAITLFGDKNTKNVVLEKSYEEYMNGYTDSQTGEARRGYLDVA
KELHERFPDPDKIETEKDKKDFAKLFGEYLRAENVLQNYDEFAALRELQN
VDAADEDAMKAFQEKYYLSDEDVQEMRKVPMPSERAVQDYRSAYNDIRDW
LRRQKAGEQKEQSKIDWDDVVFEVDLLKSQEINLDYILQLVFEHHKKIKG
KAELVEEIRRIIRASIGHRAKEGLIVDFINDTDLDKVPDVPAILETFYTY
AQEVMRHEAAGLIAAEGLNETAAKRYLTGSLKRGYASENGTELTETLPKM
SPLNPQYLTKKQSVFQKIAAFVEKFAGIGADI

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCTCGAAACCAAACCCATCGCCGAAACGCCGAATTTCATCGTGCT
CGACCAATATGAAAAAATCGAACAGTCGGGCAGCTACCAATCGGAAAACC
GGTTGGAAGCGGAGTTAATCGCCGATTTGCAGAATCAGGGGTACGAATAC
CGCAAGGATTTGAACAGCCAAAGCAGGCTGCTGGAAAACCTGCGCGCCCA
GTTGCAGCGGCTGAACGATGTGGCGTTTTCAGACGGCGAATGGGCGCGGT
TTTTGACGGAATATCTGGACAGGCCGGCTGAAAACATTACCGATAAAACC
CGCAAAATCCACGACGACCATATTTACGATTTCGCTTTTGATGACGGCCG
TCTGAAAAACATTTATCTGCTGGACAAGAAAAACCTTGCCCGCAACCATG
TGCAGCTTATCAACCAGTTTGAGCAGACGGGCACGCATGCAAACCGTTAT
GACGTTACCGTGTTGGTAAACGGCCTGCCGCTGGTGCAGATTGAATTGAA
AAAGCGCGGTGTGGCGGTGCGCGAGGCATTCAATCAGGTGCACCGTTACA
GCAAAGAGAGCTTCAACAGCGGAAATTCGCTGTTCAAATTCCTGCAAATC
TTCGTGATTTCCAACGGCACGGACACGCGCTATTTCGCCAACACCACCAA
GCGCGACAAAAACAGCTTCGATTTCACGATGAATTGGGCGCGGTCGGACA
ATCATCCGATTAAGGATTTGAAAGACTTTACCGCCACGTTCCTGCAAAAA
AGCGTATTGCTGAGCGTTTTGCTGCATTACAGCGTGTTCGATGCGAATGA
TACGCTGCTGATTATGCGGCCGTACCAGATTGCCGCCGCCGAACGCATTT
TGTGGAAAATCAACAGCTCGGCGCAGGCGAAGAATTGGAGCGGGCCGGAA
AGCGGCGGCTATGTTTGGCATACCACGGGCAGCGGCAAAACGCTGACCGG
CTTTAAGGCGGCGCGTCTGGCGACGGAATCGGCGTTTATCGACAAGGTTT
TCTTCGTGGTGGACAGGAAGGATTTGGACTATCAGACGATGAAGGAATAC
CAACGTTTTTCGCCCGACAGCGTAAACGGCTCGGAAAGTACGGCGGGCTT
GAAACGCAATTTGGAAAAAGACGGCAACAAAATCATCGTTACCACCATCC
AAAAGCTGAACAACCTGATGAAAAGTGAAGATAATCTGCCGGTTTATCAC
CGGCAGGTTGTATTTATTTTCGACGAATGCCACCGCTCGCAATTCGGCGA
AGCGCAAAAAAACCTGAAAAAGAAATTTAAAAAATTCTGCCAGTTCGGCT
TTACCGGCACGCCGATTTTTCCCGAAAACGCTTTGGGCGCGGAAACCACG
GCGGGCGTGTTCGGGCGGGAGCTGCATTCTTATGTGATTACCGATGCCAT
CCGCGATGAAAAAGTATTGAAATTCAAAGTGGATTACAACGATGTACGCC
CGCAGTTCAAAGCCGTGGAAGCGGAACAGGACGAGAAGGAACTGAGTGCC
GCCGAAAACCGCCAAGCCCTGCTGCACCCCGAACGCATCCGCGAAATCAC
GCAATATATCCTGAGCCGGTTCAGGCAGAAAACGCACCGCTTGAATGCGG
GCGGCAAAGGCTTCAACGCCATGTTTGCCGTCAGCAGCGTGGATGCGGCG
AAGTGCTATTACGAAGCGTTCAAAACACAACAGGCAGGCAGCCTGCACCC
GTTGAAAACAGCCACCATTTTTTCCTTTGCCGCCAACGAAGAGCAAAACG
CCGTCGGTGAAATTGTTGACGAGACCTTTGAACCGGAAGCGATGGACAGC
AGCGCGAAAGAATTTTTGCAGGCTGCCATCAACGATTACAACGCCTGTTT
CAAAACCAATTTCGGCACGGACAGCAAAGCCTTTCAGAACTACTACCGCG
ATTTGGCAAAACGGGTGAAAAACCGGGAAGTGGACTTGCTGATTGTGGTC
GGCATGTTTTTGACGGGTTTTGACGCACCGACGCTGAATACGCTGTTCGT
CGATAAAAACCTGCGCTATCACGGCCTGATGCAGGCGTTTTCTCGCACCA
ACCGCATTTACGATGCTACCAAAACCTTCGGCAACATTGTCTGCTTCCGC
GACTTGGAGCAGGCAACCATTGATGCGATCACGCTCTTCGGCGACAAAAA
CACCAAAAATGTAGTGCTGGAAAAAAGCTACGAAGAATACATGAACGGCT
ATACCGACAGCCAGACCGGCGAAGCACGGCGCGGTTATCTGGATGTAGCA
AAAGAATTGCACGAGCGTTTCCCCGATCCCGACAAAATCGAAACGGAAAA
AGACAAAAAAGATTTTGCCAAACTCTTCGGCGAATACCTGCGGGCGGAAA
ATGTATTGCAGAACTACGATGAATTTGCCGCGCTGCGCGAATTGCAGAAT
GTGGACGCGGCGGACGAAGATGCGATGAAGGCGTTTCAGGAAAAATACTA
CCTGAGCGACGAAGACGTGCAGGAAATGCGGAAAGTGCCGATGCCGTCTG
AAAGGGCGGTGCAGGACTACCGTTCCGCCTATAACGACATCCGAGACTGG
CTGCGCCGCCAAAAAGCAGGCGAACAGAAAGAACAGTCAAAAATCGACTG
GGACGATGTGGTTTTTGAGGTGGATTTGCTCAAATCGCAGGAAATCAATC
TGGATTACATCCTGCAACTGGTTTTCGAGCATCACAAAAAAATCAAAGGC
AAAGCGGAGCTGGTGGAAGAAATCCGCCGCATCATCCGCGCCAGCATCGG
CCACCGCGCCAAAGAGGGCCTGATTGTGGATTTCATCAACGATACGGATT
TGGATAAAGTGCCCGACGTTCCCGCCATACTGGAAACCTTTTACACCTAC
GCGCAAGAGGTGATGCGGCACGAAGCGGCAGGATTGATTGCCGCCGAAGG
CCTGAACGAAACCGCCGCCAAACGCTATTTGACCGGCTCGCTCAAACGCG
GCTATGCCAGCGAAAACGGTACGGAACTGACCGAAACCCTGCCGAAAATG
AGTCCGCTCAACCCGCAATATCTGACGAAGAAACAAAGCGTCTTCCAAAA
AATCGCGGCGTTTGTGGAGAAGTTTGCCGGAATAGGGGCCGATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy