Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0341 IGR0337 IGR0338 IGR0339 IGR0340 IGR0340.1 clpA, - NG0408 hsdS, - NG0406 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hsdM, - NG0404 hsdR, - NG0407 clpA, - NG0408 hsdS, - NG0406 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hsdM, - NG0404 hsdR, - NG0407 Type: tandem, Name:  - 18 clpA, - NG0408 hsdS, - NG0406 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hsdM, - NG0404 hsdR, - NG0407
* Calculated from Protein Sequence

Gene ID: NG0406

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdS  

Definition:
DNA restriction and modification endonuclease

Gene Start:
399253

Gene Stop:
399876

Gene Length:
624

Molecular Weight*:
24337

pI*:
8.90

Net Charge*:
2.21

EC:
3.1.21.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Price,C., Lingner,J., Bickle,T.A., Firman,K. and Glover,S.W.
Basis for changes in DNA recognition by the EcoR124 and EcoR124/3
type I DNA restriction and modification enzymes
J. Mol. Biol. 205 (1), 115-125 (1989)
MEDLINE: 89178628


Comment:


Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to hsdS proteins and to type I site-specific deoxyribonucleases. Residues 1-200 are 34% similar to X13145, a predicted hsdS protein from Escherichia coli. Residues 6-200 are 30% similar to gb|AAD07897.1, a type I restriction enzyme S protein (hsdS) from Helicobacter pylori.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0732
COG name: Restriction endonuclease S subunits
Functional Class:  L
The phylogenetic pattern of COG0732 is aMt-----e-rHUJgP-----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0406 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 19 to 170 (E-value = 7.4e-18) place NG0406 in the Methylase_S family which is described as Type I restriction modification DNA specificity domain (PF01420)

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MDMQSKAKKLIEMIQTAPVEWKPLGEVLVRTKGTKITAGQMKEMHKDNAP
LKIFAGGKTFALVDFDDVPDKDIHREPSIIVKSRGIIEFEYYDKPFSHKN
EMWSYHSVNKHIYIKYVYYFLKTQENYFRNIGSKMQMPQIATPDTDNYKI
PIPSLETQQKIVKILDKFTELEATLEATLEAELALRKRQYRYYRDLLLDF
DNQIGGDS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATATGCAAAGCAAAGCGAAAAAATTGATTGAGATGATTCAGACGGC
ACCGGTGGAGTGGAAGCCATTGGGGGAGGTTTTAGTTCGTACAAAAGGAA
CTAAGATAACTGCTGGACAAATGAAAGAAATGCATAAAGATAATGCGCCG
TTAAAGATTTTTGCAGGAGGAAAAACTTTTGCATTAGTTGACTTTGATGA
TGTTCCTGATAAGGATATCCATAGAGAGCCTTCTATTATCGTTAAATCAA
GAGGTATTATTGAATTCGAATATTACGATAAACCATTTTCGCATAAAAAT
GAAATGTGGTCTTATCATTCAGTTAATAAACATATTTATATAAAATATGT
TTATTATTTCTTAAAAACACAAGAAAACTATTTTCGTAATATCGGATCAA
AAATGCAAATGCCACAAATAGCAACACCAGATACAGATAACTATAAAATC
CCCATCCCATCATTGGAAACCCAACAAAAAATTGTAAAAATACTTGACAA
ATTCACCGAGCTGGAAGCTACGCTGGAAGCTACGCTGGAAGCGGAATTAG
CCCTGCGCAAACGCCAATACCGGTATTACCGCGACTTACTTTTAGATTTT
GACAATCAAATCGGGGGGGATAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy