Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0336 IGR0337 IGR0338 IGR0339 IGR0340 IGR0334 IGR0335 IGR0340.1 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hsdM, - NG0404 hsdR, - NG0407 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hsdM, - NG0404 hsdR, - NG0407 Type: tandem, Name:  - 18 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hsdM, - NG0404 hsdR, - NG0407
* Calculated from Protein Sequence

Gene ID: NG0404

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdM  

Definition:
type I restriction enzyme EcoR124II M protein (putative type I restriction-modification system protein)

Gene Start:
396575

Gene Stop:
398116

Gene Length:
1542

Molecular Weight*:
57469

pI*:
4.90

Net Charge*:
-20.20

EC:
2.1.1.72  3.1.21.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Price,C., Lingner,J., Bickle,T.A., Firman,K. and Glover,S.W. 1989. Basis for changes in DNA recognition by the EcoR124 and EcoR124/3
type I DNA restriction and modification enzymes. J. Mol. Biol. 205 (1): 115-125. Medline: 89178628.


Comment:
Oklahoma ID: NGO.404

For other 'hsd' genes, see NG0407 (hsdR), NG0697 (hsdR), NG0699 (hsdS), NG0702 (hsdM).

Blast Summary:  PSI-Blast Search
NG0404 is orthologously related to AE002436, Neisseria meningitidis, strain MC58, a type I restriction enzyme EcoR124II M protein: residues 1-513 are 97% similar to residues 1-513 of NG0404. NG0404 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative type I restriction-modification system protein: residues 1-513 are 97% similar to residues 1-513 of NG0404.

Numerous significant hits in gapped BLAST; e.g. residues 2-513 are 75% similar to 135199 type I restriction enzyme EcoR124II M protein (M.ECOR124II) of Escherichia coli, residues 7-513 are 52% similar to gb|AAD07898.1| type I restriction enzyme M protein of Helicobacter pylori 26695, residues 6-513 are 53% similar to gb|AAF85513.1|AE004079_4 type I restriction-modification system DNA methylase of Xylella fastidiosa.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0286
COG name: Type I restriction-modification system methyltransferase subunit
Functional Class:  L
The phylogenetic pattern of COG0286 is -Mt-----e-rhUJ-p-----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR00507 (N12 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 1.1e-26.
    PR00507A    196-212
    PR00507B    222-236
    PR00507C    295-307
    PR00507D    333-357


ProDom Summary:  Protein Domain Search
Residues 56-170 are 67% similar to a (TYPE I RESTRICTION ENZYME) protein domain (PD011415) which is seen in Q47163_ECOLI.

Residues 172-308 are 83% similar to a (METHYLTRANSFERASE RESTRICTION PROTEIN TRANSFERASE ENZYME) protein domain (PD002294) which is seen in Q47163_ECOLI.

Residues 309-484 are 77% similar to a (RESTRICTION PROTEIN TYPE I) protein domain (PD002458) which is seen in Q47163_ECOLI.

Residues 10-49 are 82% similar to a (TYPE I RESTRICTION ENZYME) protein domain (PD004658) which is seen in Q47163_ECOLI.

Residues 370-511 are 28% similar to a (PROTEIN ORF PUTATIVE KINASE) protein domain (PD000146) which is seen in Q50358_MYCPU.



Paralogs:  Local Blast Search


NG0404 is paralogously related to NG0702 (type I restriction enzyme M protein HsdM) (1e-37) and NG1615 (conserved hypothetical protein (type I restriction enzyme related)) (5e-06).


Pfam Summary:  Pfam Search
Residues 7 to 255 (E-value = 4.8e-123) place NG0404 in the Methylase_M family which is described as Type I restriction modification system, M protein (PF02506)
Residues 306 to 466 (E-value = 1.6e-69) place NG0404 in the N6_Mtase family which is described as N-6 DNA Methylase (PF02384)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
382  
398
coil-coil  
484  
514

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MMTEMQQRAQLHRQIWKIADEVRGAVDGWDFKQYVLGTLFYRFISENFTD
YMQAGDSSIDYAAMPDSIITPEIKDDAVKVKGYFIYPGQLFCNIAAEAHQ
NEELNTKLKEIFTAIESSASGYPSEQGIKGLFDDFDTTSSRLGSTVADKN
KRLAAVLKGVAELDFGNFEDHRIDLFGDAYEYLISNYAANAGKSGGEFFT
PQSVSKLIARLAVHGQEKVNKIYDPACGSGSLLLQAKKQFDEHIIEEGFF
GQEINHTTYNLARMNMFLHNVNYNKFHIELGDTLTNPKLKDSKPFDAVVS
NPPYSIDWIGSDDPTLINDDRFAPAGVLAPKSKADFAFILHALNYLSGRG
RAAIVSFPGIFYRGGAEQKIRQYLVEGNYVETVIALAPNLFYGTCIAVNI
LVLSKHKDNTDIQFIDASGFFKKETNNNVLTEEHIAEIVKLFADKADVPH
IAQNAAQQTVKDNGYNLAVSSYVEAEDTREVIDIRQLNAEISETVAKIER
LRREIDEVIAEIET

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGACCGAAATGCAACAACGCGCCCAACTGCACCGCCAAATTTGGAA
AATCGCCGACGAAGTACGCGGCGCGGTGGATGGCTGGGACTTTAAACAAT
ACGTTCTCGGCACACTTTTCTACCGCTTTATCAGCGAAAACTTCACCGAC
TATATGCAGGCCGGCGACAGCAGCATTGATTACGCCGCTATGCCGGACAG
CATCATCACGCCCGAAATCAAAGACGATGCCGTCAAAGTCAAAGGCTATT
TCATCTACCCCGGCCAGCTTTTTTGCAATATTGCCGCCGAAGCCCATCAA
AACGAAGAGCTCAACACCAAGCTGAAAGAAATCTTTACCGCGATTGAAAG
CTCCGCCTCCGGCTACCCGTCCGAACAAGGCATCAAAGGCTTGTTTGACG
ACTTCGACACCACCAGCAGCCGGCTCGGCAGCACCGTTGCCGACAAAAAC
AAACGCCTTGCCGCCGTCCTTAAAGGCGTGGCGGAACTCGATTTCGGCAA
TTTTGAAGACCACCGCATCGACCTTTTCGGTGATGCCTACGAATACCTGA
TTTCCAACTACGCCGCCAACGCAGGCAAATCCGGCGGCGAATTTTTCACC
CCGCAAAGCGTCTCCAAGCTGATTGCGCGGCTGGCGGTGCACGGGCAGGA
GAAAGTCAACAAAATCTACGACCCCGCCTGCGGCTCGGGCAGCCTGCTCT
TGCAGGCGAAAAAACAGTTTGACGAACACATCATCGAAGAAGGCTTCTTC
GGGCAGGAAATCAACCACACCACCTACAACCTCGCCCGCATGAATATGTT
TCTGCACAACGTCAATTACAACAAATTCCACATCGAATTGGGCGACACGC
TGACCAACCCCAAACTCAAAGACAGCAAACCCTTTGATGCCGTCGTCTCC
AATCCGCCCTATTCCATCGACTGGATAGGCAGCGACGACCCCACCTTGAT
CAACGACGACCGCTTTGCCCCCGCAGGCGTACTCGCACCGAAATCCAAAG
CCGATTTTGCCTTCATCCTGCACGCACTGAACTACCTTTCCGGCAGAGGC
CGCGCCGCTATCGTCTCATTCCCCGGCATTTTCTATCGCGGCGGCGCAGA
GCAGAAAATCCGCCAATATCTGGTGGAGGGCAACTATGTGGAAACCGTGA
TTGCCCTTGCGCCCAATCTCTTTTACGGCACCTGCATCGCCGTCAATATC
CTGGTTTTGTCCAAACACAAAGACAATACCGACATCCAATTCATCGACGC
AAGCGGCTTCTTTAAAAAAGAAACCAACAACAACGTCTTAACCGAAGAAC
ACATTGCCGAAATCGTCAAACTCTTCGCCGACAAAGCCGATGTGCCGCAT
ATCGCCCAAAACGCCGCCCAGCAAACCGTCAAAGACAACGGCTACAACCT
CGCCGTCAGCAGCTATGTCGAAGCCGAAGACACCCGCGAGGTCATCGACA
TCAGACAGCTCAACGCCGAAATCAGCGAAACCGTCGCCAAAATCGAACGG
CTGCGGCGTGAAATTGACGAAGTGATTGCAGAGATTGAAACC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy