Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0336 IGR0337 IGR0338 IGR0339 IGR0340 IGR0334 IGR0333 IGR0335 IGR0340.1 htpX, - NG0399 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 purA, - NG0398 hsdM, - NG0404 hsdR, - NG0407 htpX, - NG0399 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 purA, - NG0398 hsdM, - NG0404 hsdR, - NG0407 Type: tandem, Name:  - 18 htpX, - NG0399 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 purA, - NG0398 hsdM, - NG0404 hsdR, - NG0407
* Calculated from Protein Sequence

Gene ID: NG0403

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gme  rfaD  

Definition:
ADP-L-glycero-D-mannoheptose epimerase

Gene Start:
395496

Gene Stop:
396497

Gene Length:
1002

Molecular Weight*:
38360

pI*:
6.10

Net Charge*:
-6.27

EC:
5.1.3.20  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Primary Evidence:
Drazek,E.S., Stein,D.C. and Deal,C.D. 1995. A mutation in the Neisseria gonorrhoeae rfaD homolog results in altered lipooligosaccharide expression. J. Bacteriol. 177 (9): 2321-2327. Medline: 95247663.


Secondary Evidence:
Ding,L., Seto,B.L., Ahmed,S.A. and Coleman,W.G. Jr.
Purification and properties of the Escherichia coli K-12
NAD-dependent nucleotide diphosphosugar epimerase,
ADP-L-glycero-D-mannoheptose 6-epimerase
J. Biol. Chem. 269 (39), 24384-24390 (1994)
Medline: 95014184


Comment:
Oklahoma ID: NGO.403

For other 'rfa' genes, see NG0402 (rfaE), NG0987 (rfaF), NG1354 (rfaK), NG1934 (rfaC).


Blast Summary:  PSI-Blast Search
NG0403 is 99% identical to a previously sequenced N.gonorrhoeae protein, ADP-L-glycero-D-mannoheptose epimerase, in GenBank, 293973.

NG0403 is orthologously related to AE002436, Neisseria
meningitidis, strain MC58, a ADP-L-glycero-D-mannoheptose-6-epimerase protein: residues 1-334 are 97% similar to residues 1-334 of NG0403.

Numerous significant hits in gapped BLAST; e.g. residues 1-333 are 62% similar to 5442432 putative ADP-glycero-mannoheptose epimerase of Burkholderia pseudomallei, residues 1-329 are 54% similar to gb|AAG06725.1|AE004756_3 ADP-L-glycero-D-mannoheptose 6-epimerase of Pseudomonas aeruginosa, residues 3-329 are 52% similar to gb|AAC76643.1| ADP-L-glycero-D-mannoheptose-6-epimerase of Escherichia coli K12.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0451
COG name: Nucleoside-diphosphate-sugar epimerases
Functional Class:  M,G
The phylogenetic pattern of COG0451 is AMTKYQVCEBRHUJ--o----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001509 (NAD dependent epimerase/dehydratase family) with a combined E-value of 2e-15.
    IPB001509A    3-24
    IPB001509B    70-104
    IPB001509D    216-223
***** IPB002225 (3-Beta hydroxysteroid dehydrogenase/isomerase family) with a combined E-value of 2.2e-06.
    IPB002225A    0-30


ProDom Summary:  Protein Domain Search
Residues 3-332 are 91% similar to a (PROTEIN OXIDOREDUCTASE DEHYDROGENASE REDUCTASE NAD NADP) protein domain (PD000038) which is seen in Q51061_NEIGO.



Paralogs:  Local Blast Search


NG0403 is paralogously related to NG1896 (UDPglucose 4-epimerase) (2e-12) and NG1897 (dTDP-glucose 4,6-dehydratase) (2e-06).


Pfam Summary:  Pfam Search
Residues 2 to 333 (E-value = 3.2e-05) place NG0403 in the 3Beta_HSD family which is described as 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073)
Residues 3 to 333 (E-value = 3.9e-15) place NG0403 in the Epimerase family which is described as NAD dependent epimerase/dehydratase family (PF01370)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
19

PDB Hit:
pdb|1EQ2|1EQ2-A THE CRYSTAL STRUCTURE OF 309.0 4e-85
pdb|1I3K|1I3K-A MOLECULAR BASIS FOR SEVERE EPIMERASE-DEFICIENCY 57.8 3e-09
pdb|1LRK|1LRK-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 56.2 8e-09
pdb|1HZJ|1HZJ-A HUMA

Gene Protein Sequence:
MTIIVTGAAGFIGSNIVKALNQRGITDIVAVDNLTKGEKFKNLAECEIAH
YLDKHEFIRQVREHILPYQNIEAVFHQGACSDTMNHDGLYMMENNYQYTL
DLLDWCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYGYSKFLFDQ
VLRRRMKEGLTAQVVGFRYFNVYGQHEQHKGRMASVAFHHFHQYREHGYV
NLFGSNDGYGNGEQTRDFVSVEDVAKINLYFFDHPELSGIYNLGTGRSQQ
FNELAAAAVNACRAAEGKSELSLKELVEEELIRYIPFPDALKGKYQGFTQ
ADITKLREAGYKEEFFDVKAGVNRYVKWMLENLA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCATCATCGTAACAGGCGCGGCCGGCTTTATCGGCAGCAACATCGT
CAAAGCCCTCAACCAACGCGGCATTACCGACATCGTCGCCGTCGATAATC
TGACAAAAGGCGAAAAATTCAAAAACCTTGCCGAGTGCGAAATCGCCCAT
TATCTCGACAAACACGAATTTATCCGCCAAGTGAGGGAACACATTTTACC
TTATCAAAACATCGAAGCCGTTTTCCATCAAGGCGCGTGTTCCGATACGA
TGAACCACGACGGTTTGTATATGATGGAAAACAACTACCAGTACACGCTG
GATTTGTTGGACTGGTGTCAGGACGAACGCATCCCCTTCCTTTATGCCTC
CAGTGCGGCGGTTTACGGCAAAGGCGAAATCTTCCGCGAAGAGCGCGAAC
TCGAAAAACCGCTTAATGTGTACGGCTACTCCAAATTCCTGTTTGACCAA
GTATTGCGCCGCCGCATGAAAGAAGGTCTCACCGCCCAAGTCGTCGGCTT
CCGCTACTTCAACGTTTACGGACAACACGAACAACACAAAGGCCGCATGG
CATCCGTCGCCTTCCACCATTTCCACCAATACCGCGAACACGGTTACGTC
AACCTGTTCGGCAGCAACGACGGCTACGGCAACGGCGAACAAACCCGCGA
CTTCGTCAGCGTCGAAGACGTCGCCAAAATCAACCTCTACTTCTTCGACC
ATCCCGAACTTTCCGGCATCTACAACCTCGGCACCGGCCGCAGCCAACAG
TTCAACGAACTCGCCGCCGCCGCCGTCAACGCCTGCCGCGCCGCCGAAGG
CAAATCTGAATTGAGCTTGAAAGAGTTGGTAGAAGAAGAACTTATCCGCT
ATATCCCCTTTCCCGACGCGCTCAAAGGCAAATACCAGGGCTTCACCCAA
GCCGACATCACCAAATTGCGCGAAGCCGGATATAAGGAAGAATTTTTCGA
TGTCAAAGCAGGTGTCAACCGCTACGTCAAATGGATGCTGGAAAATTTGG
CT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy