Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0336 IGR0337 IGR0338 IGR0339 IGR0340 IGR0334 IGR0333 IGR0335 IGR0340.1 htpX, - NG0399 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 purA, - NG0398 hsdM, - NG0404 htpX, - NG0399 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 purA, - NG0398 hsdM, - NG0404 Type: tandem, Name:  - 18 htpX, - NG0399 hsdS, - NG0406 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 purA, - NG0398 hsdM, - NG0404
* Calculated from Protein Sequence

Gene ID: NG0402

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rfaE  

Definition:
ribokinase (ADP-heptose synthase) (DP-heptose synthetase)

Gene Start:
394470

Gene Stop:
395429

Gene Length:
960

Molecular Weight*:
34660

pI*:
5.00

Net Charge*:
-8.16

EC:
2.7.-.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Energy metabolism; Sugars  

Pathway: pathway table

Primary Evidence:
Drazek,E.S., Stein,D.C. and Deal,C.D. 1995.
A mutation in the Neisseria gonorrhoeae rfaD homolog results in altered lipooligosaccharide expression.
J. Bacteriol. 177 (9): 2321-2327. Medline: 95247663.




Comment:
For other 'rfa' genes, see NG0403 (rfaD), NG0987 (rfaF), NG1354 (rfaK), NG1934 (rfaC).

Oklahoma ID: NGO.402

Blast Summary:  PSI-Blast Search
NG0402 is 99% identical to a previously sequenced N.gonorrhoeae protein, ribokinase, in GenBank, 1017464.

NG0402 is orthologously related to AE002435, Neisseria meningitidis, strain MC58, a putative ADP-heptose synthase protein: residues 1-320 are 96% similar to residues 1-320 of NG0402. NG0402 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative DP-heptose synthetase protein: residues 1-320 are 95% similar to residues 1-320 of NG0402.

Numerous significant hits in gapped BLAST; e.g. residues 11-313 are 55% similar to 5442431 putative ADP-heptose synthase of Burkholderia pseudomallei, residues 14-320 are 51% similar to 13383336 ADP-heptose synthase of Salmonella typhimurium, residues 14-320 are 50% similar to dbj|BAB37358.1| ADP-heptose synthase of Escherichia coli O157:H7.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0524
COG name: Sugar kinases, ribokinase family
Functional Class:  G
The phylogenetic pattern of COG0524 is AMTKYqVCEBRHuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002173 (PfkB family of carbohydrate kinases) with a combined E-value of 2.4e-10.
    IPB002173A    55-70
    IPB002173B    262-276


ProDom Summary:  Protein Domain Search
Residues 120-245 are 48% similar to a (SYNTHASE ADP-HEPTOSE LIPOPOLYSACCHARIDE) protein domain (PD010962) which is seen in RFAE_HAEIN.

Residues 251-317 are 58% similar to a (SYNTHASE ADP-HEPTOSE LIPOPOLYSACCHARIDE BIOSYNTHESIS) protein domain (PD013115) which is seen in RFAE_ECOLI.

Residues 19-118 are 51% similar to a (KINASE TRANSFERASE PROTEIN FRUCTOKINASE) protein domain (PD001280) which is seen in RFAE_ECOLI.



Paralogs:  Local Blast Search


NG0402 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 313 (E-value = 1.1e-29) place NG0402 in the PfkB family which is described as pfkB family carbohydrate kinase (PF00294)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
33  
126
non-globular  
266  
320
transmembrane  
298  
314

PDB Hit:
pdb|1GQT|1GQT-A ACTIVATION OF RIBOKINASE BY MONOVALENT CATIONS 43.0 7e-05
pdb|1J5V|1J5V-A CRYSTAL STRUCTURE OF 2-KETO-3-DEOXYGLUCONATE 47.7 3e-06
pdb|1BX4|1BX4-A STRUCTURE OF HUMAN ADENOSINE KINASE AT 1.50 47.3 4e-06
pdb|1J5V|1J5V-A CRYS

Gene Protein Sequence:
MPAKFQQETLKSRFAQAKVLVVGDVMLDRYWFGDVSRISPEAPVPVAKIG
RIDQRAGGAANVARNIASLGGRAGLLSVTGDDEAAAALDALMVQDGVASY
LMRDKQIATTVKLRVVARNQQLIRLDFEEHPNREVLEQIKRKYREILPEY
DAIIFSDYGKGGLSHISDMIDWAKHVGKTVLIDPKGDDYEKYVGATLITP
NCAELKEVVGSWKNEGDLTEKAQNLRRHLDLTAVLLTRSEEGMTLFSEGE
PIYQPTRAQEVYDVSGAGDTVIAGMGLGLAAGCTMPEAMYLANTAAGVVV
AKLGTAVCSFAELVEALDGQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCGCCAAGTTCCAACAAGAAACCCTCAAATCCCGTTTCGCACAAGC
CAAAGTTCTTGTTGTCGGCGACGTGATGCTCGACCGCTATTGGTTTGGCG
ACGTGTCCCGAATTTCGCCCGAAGCACCCGTGCCGGTGGCAAAAATCGGA
CGAATCGACCAACGGGCGGGCGGCGCGGCGAACGTTGCGCGCAACATCGC
TTCGTTGGGCGGCAGGGCAGGGCTGTTGTCCGTAACCGGCGACGACGAAG
CCGCCGCCGCGCTCGACGCGCTGATGGTGCAGGACGGCGTCGCCTCCTAT
CTGATGCGCGACAAACAAATCGCCACCACCGTCAAACTGCGCGTCGTCGC
CCGCAACCAGCAGCTTATCCGCCTTGATTTTGAAGAACATCCCAACCGCG
AAGTGTTGGAACAAATCAAGCGGAAATACCGCGAAATCTTGCCCGAATAC
GACGCAATCATTTTTTCGGACTACGGCAAAGGCGGTCTGTCGCATATCTC
CGATATGATCGATTGGGCGAAACATGTCGGCAAAACCGTCTTAATCGACC
CCAAAGGCGACGATTACGAAAAATATGTCGGCGCAACTCTGATTACGCCC
AACTGCGCCGAATTGAAAGAAGTGGTTGGCAGTTGGAAAAACGAAGGCGA
TCTGACCGAAAAAGCGCAAAACCTGCGCCGCCACCTCGACTTGACCGCCG
TTTTGCTGACCCGGAGCGAAGAGGGCATGACCCTGTTCAGCGAAGGCGAA
CCCATTTACCAGCCCACCCGCGCCCAAGAAGTTTACGACGTGTCCGGCGC
AGGCGACACCGTCATTGCCGGAATGGGCTTGGGGCTGGCGGCAGGCTGCA
CCATGCCCGAAGCCATGTACCTTGCCAATACTGCGGCCGGGGTTGTCGTG
GCGAAACTCGGTACGGCGGTTTGCTCGTTTGCAGAGTTGGTTGAAGCACT
GGACGGGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy