Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0336 IGR0337 IGR0338 IGR0332 IGR0339 IGR0334 IGR0333 IGR0335 htpX, - NG0399 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404 htpX, - NG0399 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404 htpX, - NG0399 adk, - NG0400 pyrF, - NG0401 dinD, - NG0405 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404
* Calculated from Protein Sequence

Gene ID: NG0401

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrF  

Definition:
orotidine 5`-phosphate decarboxylase (OMP decarboxylase)

Gene Start:
393674

Gene Stop:
394411

Gene Length:
738

Molecular Weight*:
26491

pI*:
5.40

Net Charge*:
-4.17

EC:
4.1.1.23  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Turnbough,C.L., Kerr,K.H., Funderburg,W.R., Donahue,J.P. and
Powell,F.E. 1987. Nucleotide sequence and characterization of the pyrF operon of Escherichia coli K12. J. Biol. Chem. 262 (21): 10239-10245. Medline: 87280048.


Comment:
Oklahoma ID: NGO.401


For other 'pyr' genes, see NG0029 (pyrE), NG0255 (pyrC), NG1876 (pyrI), NG0589 (pyrP), NG1212 (pyrG), NG1761 (pyrD), NG1973 (pyrH).

Blast Summary:  PSI-Blast Search
NG0401 is orthologously related to AE002435, Neisseria meningitidis, strain MC58, a orotidine 5`-phosphate decarboxylase protein: residues 1-246 are 97% similar to residues 1-246 of NG0401.

Numerous significant hits to orotidine-5'-phosphate decarboxylase (OMP decarboxylase) in gapped BLAST; e.g. residues 17-238 are 58% similar to gb|AAF95059.1| orotidine 5`-phosphate decarboxylase of Vibrio cholerae, residues 17-238 are 57% similar to gb|AAC22877.1 orotidine 5'-phosphate decarboxylase of Haemophilus influenzae Rd, residues 15-238 are 54% similar to gb|AAC74363.1| orotidine-5'-phosphate decarboxylase of Escherichia coli K12.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0284
COG name: Orotidine-5'-phosphate decarboxylase
Functional Class:  F
The phylogenetic pattern of COG0284 is amtkyqvceb-huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 15-76 are 50% similar to a (DECARBOXYLASE OROTIDINE 5'-PHOSPHATE OMP PYRIMIDINE) protein domain (PD186347) which is seen in DCOP_ECOLI.

Residues 77-238 are 56% similar to a (DECARBOXYLASE OROTIDINE PYRIMIDINE) protein domain (PD001042) which is seen in DCOP_HAEIN.



Paralogs:  Local Blast Search


NG0401 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 15 to 237 (E-value = 1.5e-81) place NG0401 in the OMPdecase family which is described as Orotidine 5'-phosphate decarboxylase / HUMPS family (PF00215)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
51

PDB Hit:
pdb|1EIX|1EIX-A STRUCTURE OF OROTIDINE 5'-MONOPHOSPHATE 226.0 3e-60
pdb|1DBT|1DBT-A CRYSTAL STRUCTURE OF OROTIDINE 5'-MONOPHOSPHATE 140.0 2e-34
pdb|1LOQ|1LOQ-A CRYSTAL STRUCTURE OF OROTIDINE MONOPHOSPHATE 49.6 6e-07
pdb|1DVJ|1DVJ-A CRYS

Gene Protein Sequence:
MNPLITDFQTPQQRTPVIVALDFANEKDTLGFVRNLDPALCQIKIGKELF
TATGRSLAESLIHQGFKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHA
SGGRRMMEAAAEAVAGYGTKPLLIGVTVLTSMEQSDLAEIGLNTAPEEQV
IRLAKLAQSSGLDGVVCSAQEAAPLRRELGRDFVLVTPGIRLDVAGNNDD
QRRIMTPAEALAAGSTYLVMGRPVTRAADPVAVLREVNRVANLEAN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCCTTTAATCACCGACTTCCAAACTCCGCAACAACGTACCCCCGT
CATCGTTGCCCTTGATTTTGCCAACGAAAAAGACACGCTCGGATTCGTCC
GCAACCTTGATCCGGCGTTGTGCCAAATCAAAATCGGCAAAGAGCTGTTT
ACCGCTACGGGGCGCAGTTTGGCGGAAAGCCTGATTCATCAGGGTTTCAA
ACTCTTTCTTGATTTGAAATACCACGATATTCCCCACACCGTCGCGCAGG
CGTGTAAAGTCGCCGCCGATATGGGCGTGTGGATGGTCGATATGCACGCG
TCGGGCGGCAGACGTATGATGGAAGCCGCCGCCGAAGCCGTTGCCGGATA
CGGCACGAAACCGCTCTTAATCGGCGTAACCGTGTTGACCAGCATGGAGC
AAAGCGATTTGGCGGAAATCGGTTTGAACACCGCCCCTGAAGAACAAGTC
ATCCGTTTGGCAAAACTGGCACAAAGTTCGGGCTTGGACGGCGTGGTCTG
TTCCGCCCAAGAAGCCGCGCCGCTGCGCCGCGAATTGGGACGGGATTTTG
TCTTGGTTACACCGGGTATCCGCTTGGACGTTGCCGGCAACAACGACGAC
CAACGCCGCATTATGACACCCGCCGAAGCCTTGGCGGCGGGTTCGACTTA
TCTGGTGATGGGCCGCCCCGTTACCCGAGCCGCCGATCCGGTCGCCGTAT
TGCGCGAAGTGAACCGCGTGGCAAACCTTGAAGCAAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy