Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0330 IGR0336 IGR0337 IGR0338 IGR0331 IGR0332 IGR0334 IGR0333 IGR0335 htpX, - NG0399 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404 htpX, - NG0399 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404 htpX, - NG0399 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404
* Calculated from Protein Sequence

Gene ID: NG0400

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
adk  

Definition:
adenylate kinase (ATP-AMP transphosphorylase)

Gene Start:
392503

Gene Stop:
393147

Gene Length:
645

Molecular Weight*:
23109

pI*:
5.00

Net Charge*:
-7.07

EC:
2.7.4.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Primary Evidence:
Feil,E., Carpenter,G. and Spratt,B.G. 1995. Electrophoretic variation in adenylate kinase of Neisseria meningitidis is due to inter- and intraspecies recombination. Proc. Natl. Acad. Sci. U.S.A. 92 (23): 10535-10539. Medline: 96068650.

Vazquez,J.A., Berron,S., O'Rourke,M., Carpenter,G., Feil,E.,
Smith,N.H. and Spratt,B.G.
Interspecies recombination in nature: a meningococcus that has
acquired a gonococcal PIB porin
Mol. Microbiol. 15 (6), 1001-1007 (1995)
M:95349386



Secondary Evidence:
Reinstein,J., Brune,M. and Wittinghofer,A.
Mutations in the nucleotide binding loop of adenylate kinase of
Escherichia coli
Biochemistry 27 (13), 4712-4720 (1988)
M:89000670

Reinstein,J., Schlichting,I. and Wittinghofer,A.
Structurally and catalytically important residues in the phosphate
binding loop of adenylate kinase of Escherichia coli
Biochemistry 29 (32), 7451-7459 (1990)
M:91027759

Muller,C.W. and Schulz,G.E.
Structure of the complex between adenylate kinase from Escherichia
coli and the inhibitor Ap5A refined at 1.9 A resolution. A model
for a catalytic transition state
J. Mol. Biol. 224 (1), 159-177 (1992)
M:92194314


Comment:
Oklahoma ID: NGO.400

Blast Summary:  PSI-Blast Search
NG0400 is identical to a previously sequenced N.gonorrhoeae protein, adenylate kinase (ATP-AMP transphosphorylase), in GenBank, 845616.

NG0400 is orthologously related to AE002435, Neisseria meningitidis, strain MC58, a adenylate kinase protein: residues 1-215 are 98% similar to residues 1-215 of NG0400. NG0400 is orthologously related to Neisseria mucosa, Neisseria lactamica, Neisseria pharyngis var. flava, Neisseria flavescens, Neisseria cinerea, Neisseria polysaccharea, and Neisseria animalis adenylate kinase proteins.

Numerous significant hits to adenylate kinase proteins in gapped BLAST; e.g. residues 1-213 are 72% similar to dbj|BAA75818.1| adenylate kinase of Pseudomonas putida, residues 1-213 are 65% similar to gb|AAF94147.1| adenylate kinase of Vibrio cholerae, residues 1-213 are 63% similar to emb|CAA82801.1| adenylate kinase of Bordetella pertussis.


COGS Summary:  COGS Search
BeTs to 15 clades of COG0563
COG name: Adenylate kinase/yeast uridylate kinase
Functional Class:  F
The phylogenetic pattern of COG0563 is a--kYqvCebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000850 (Adenylate kinase) with a combined E-value of 1.4e-73.
    IPB000850A    4-36
    IPB000850B    76-90
    IPB000850C    111-141
    IPB000850D    156-182
    IPB000850A    22-54
    IPB000850A    39-71


ProDom Summary:  Protein Domain Search
Residues 13-184 are 91% similar to a (KINASE ADENYLATE TRANSFERASE ATP-BINDING) protein domain (PD000657) which is seen in KAD_NEIGO.

Residues 185-215 are identical to a (ADENYLATE KINASE ATP-AMP) protein domain (PD022012) which is seen in KAD_NEIGO.



Paralogs:  Local Blast Search


NG0400 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 187 (E-value = 4.9e-86) place NG0400 in the ADK family which is described as Adenylate kinase (PF00406)
Residues 123 to 158 (E-value = 8.1e-21) place NG0400 in the ADK_lid family which is described as Adenylate kinase, active site lid (PF05191)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
95

PDB Hit:
pdb|1E4Y|1E4Y-A MUTANT P9L OF ADENYLATE KINASE FROM E. COLI, 235.0 6e-63
pdb|1AKE|1AKE-A ADENYLATE KINASE (E.C.2.7.4.3) COMPLEX WITH THE 235.0 6e-63
pdb|1E4V|1E4V-A MUTANT G10V OF ADENYLATE KINASE FROM E. COLI, 235.0 6e-63
pdb|1AKY|1AKY MOL_I

Gene Protein Sequence:
MKALLLGAPGAGKGTQAQFITAAFGIPQISTGDMLRAAIKAGTPLGLEAK
KIIDEGGLVRDDIIIGMVKERIAQDDCKNGFLFDGFPRTLAQAEAMVEAG
VGLDAVVEIDVSDSVIVDRMSGRRVHLASGRTYHVTYNPPKTEGKDDVTG
EDLIQRDDDKEETVKKRLAVYHEQTEVLVDFYSKLEGEHAPKYIKVDGTQ
AVEAVKAEVLGALGK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGCATTACTTTTAGGCGCACCGGGCGCGGGCAAAGGCACTCAGGC
GCAATTCATCACCGCCGCGTTCGGCATTCCGCAAATCTCTACCGGCGACA
TGCTCCGTGCCGCGATTAAGGCAGGCACGCCCTTGGGTTTGGAAGCGAAA
AAAATCATCGATGAAGGCGGTTTGGTGCGCGACGACATCATTATCGGCAT
GGTCAAAGAACGCATCGCGCAAGACGACTGCAAAAACGGTTTCCTGTTCG
ACGGTTTCCCGCGTACATTGGCGCAAGCCGAAGCGATGGTGGAAGCAGGC
GTGGGTTTGGACGCGGTCGTTGAAATCGACGTATCCGACAGCGTGATTGT
CGACCGCATGAGCGGCCGCCGCGTGCATTTGGCTTCCGGCCGTACTTACC
ACGTTACCTACAATCCGCCTAAAACCGAAGGCAAAGACGACGTAACCGGC
GAAGATTTGATTCAGCGCGACGACGACAAAGAAGAAACCGTGAAAAAACG
TCTTGCCGTTTACCACGAGCAAACCGAAGTTTTGGTTGATTTTTACAGCA
AGCTGGAAGGCGAACACGCGCCGAAATACATCAAAGTCGACGGTACCCAA
GCAGTAGAAGCTGTGAAAGCCGAAGTATTGGGCGCATTGGGCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy