Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0329 IGR0330 IGR0336 IGR0337 IGR0338 IGR0331 IGR0332 IGR0334 IGR0333 IGR0335 htpX, - NG0399 murB, - NG0394 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404 htpX, - NG0399 murB, - NG0394 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404 htpX, - NG0399 murB, - NG0394 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 rfaE, - NG0402 gme,rfaD, - NG0403 hisZ,hisS, - NG0397 purA, - NG0398 hsdM, - NG0404
* Calculated from Protein Sequence

Gene ID: NG0399

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
htpX  

Definition:
heat shock protein (probable membrane-bound zinc metallopeptidase)

Gene Start:
392288

Gene Stop:
391452

Gene Length:
837

Molecular Weight*:
30126

pI*:
7.90

Net Charge*:
1.20

EC:
3.4.24.-  

Functional Class:
Other categories; Adaptations and atypical conditions  
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Kornitzer,D., Teff,D., Altuvia,S. and Oppenheim,A.B. 1991. Isolation, characterization, and sequence of an Escherichia coli
heat shock gene, htpX. J. Bacteriol. 173 (9): 2944-2953. Medline: 91210186.

Shimohata N, Chiba S, Saikawa N, Ito K, Akiyama Y.
The Cpx stress response system of Escherichia coli senses plasma membrane proteins and controls HtpX, a membrane protease
with a cytosolic active site.
Genes Cells. 2002 Jul;7(7):653-62.
PMID: 12081643

Vickerman MM, Mather NM, Minick PE, Edwards CA.
Initial characterization of the Streptococcus gordonii htpX gene.
Oral Microbiol Immunol. 2002 Feb;17(1):22-31.
PMID: 11860552 [PubMed - indexed for MEDLINE]




Comment:
Oklahoma ID: NGO.399c

Blast Summary:  PSI-Blast Search
NG0399 is orthologously related to AE002435, Neisseria meningitidis, strain MC58, a heat shock protein (HtpX): residues 69-347 are 99% similar to residues 1-279 of NG0399. NG0399 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative membrane-bound zinc metallopeptidase protein: residues 1-279 are 98% similar to residues 1-279 of NG0399.

Numerous significant hits in gapped BLAST; e.g. residues 3-279 are 59% similar to 13431564 probable protease htpX homolog of Pasteurella multocida, residues 3-278 are 55% similar to gb|AAC74899.1| heat shock protein, integral membrane protein of Escherichia coli K12, residues 3-279 are 56% similar to gb|AAC22378.1| heat shock protein (htpX) of Haemophilus influenzae Rd, residues 3-277 are 55% similar to 12515876 heat shock protein, integral membrane protein of Escherichia coli O157:H7 EDL933.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0501
COG name: Predicted Zn-dependent proteases (possible chaperone function)
Functional Class:  O
The phylogenetic pattern of COG0501 is AmTKYQ-CEBRhUJ-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 28-279 are 55% similar to a (PROTEIN PROTEASE TRANSMEMBRANE HYDROLASE) protein domain (PD002296) which is seen in HTPX_HAEIN.



Paralogs:  Local Blast Search


NG0399 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 78 (E-value = 1.1e-48) place NG0399 in the HtpX_N family which is described as HtpX N-terminus (PF06509)
Residues 83 to 279 (E-value = 5.6e-38) place NG0399 in the Peptidase_M48 family which is described as Peptidase family M48 (PF01435)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
67
uncleavable N-terminal sequence N-terminal sequence  
1  
44
transmembrane  
11  
27
transmembrane  
36  
52
transmembrane  
151  
167
transmembrane  
191  
207

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
VKRIFLFLATNIAVLVVINIVLAVLGINSRGGAGSLLAYSAVVGFTGSII
SLLMSKFIAKQSVGAEVIDTPRTEEEAWLLNTVEAQARQWNLKTPEVAIY
HSPEPNAFATGASRNSSLIAVSTGLLDHMTRDEVEAVLAHEMAHVGNGDM
VTLTLIQGVVNTFVVFLSRIIANLIARNNDGSQSQGTYFLVSMVFQILFG
FLASLIVMWFSRQREYRADAGAAKLVGAPKMISALQRLKGNPVDLPEEMN
AMGIAGDTRDSLLSTHPSLDNRIARLKSL

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAACGCATTTTTCTGTTTTTGGCTACCAATATCGCTGTTTTGGTCGT
AATCAACATTGTTTTGGCGGTTCTGGGCATCAACAGCCGGGGCGGCGCGG
GCAGCCTGTTGGCGTATTCCGCCGTCGTCGGCTTCACTGGTTCGATTATT
TCGCTGCTGATGTCCAAATTTATCGCCAAACAATCGGTCGGTGCGGAAGT
CATCGACACGCCGCGCACCGAAGAAGAAGCCTGGCTTCTGAACACTGTCG
AAGCCCAAGCGCGGCAATGGAATCTGAAAACGCCAGAAGTCGCCATCTAC
CACTCCCCCGAACCCAATGCCTTTGCCACGGGCGCATCGAGAAACAGCTC
CCTGATCGCCGTCAGCACCGGTTTGCTCGACCATATGACGCGCGACGAAG
TGGAAGCCGTGTTGGCGCACGAAATGGCGCACGTCGGCAACGGCGACATG
GTTACGCTGACGCTGATTCAAGGCGTGGTCAATACCTTTGTCGTGTTCCT
GTCGCGCATTATTGCCAACCTGATTGCCCGAAACAACGACGGCAGCCAGT
CCCAGGGAACTTATTTCCTAGTCAGCATGGTATTCCAAATCCTGTTCGGC
TTCCTTGCCAGCCTGATTGTCATGTGGTTCAGCCGCCAACGCGAATACCG
CGCCGACGCGGGCGCGGCAAAACTGGTCGGCGCACCGAAAATGATTTCCG
CCCTGCAAAGGCTTAAAGGCAACCCGGTCGATTTGCCCGAAGAAATGAAC
GCAATGGGCATCGCCGGAGATACGCGCGACTCCCTGCTCAGCACCCACCC
TTCGCTGGACAACCGAATCGCCCGCCTCAAATCGCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy