Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0328 IGR0329 IGR0326 IGR0330 IGR0327 IGR0331 IGR0332 IGR0334 IGR0333 IGR0335 NG0391 NG0393 NG0392 htpX, - NG0399 murB, - NG0394 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 hisZ,hisS, - NG0397 purA, - NG0398 NG0391 NG0393 NG0392 htpX, - NG0399 murB, - NG0394 NG0395 NG0396 adk, - NG0400 pyrF, - NG0401 hisZ,hisS, - NG0397 purA, - NG0398 NG0393 NG0392 htpX, - NG0399 murB, - NG0394 NG0395 NG0391 NG0396 adk, - NG0400 pyrF, - NG0401 hisZ,hisS, - NG0397 purA, - NG0398
* Calculated from Protein Sequence

Gene ID: NG0397

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisZ  hisS  

Definition:
histidyl-tRNA synthetase (histidine--tRNA ligase) (ATP phosphoribosyltransferase regulatory subunit)

Gene Start:
388659

Gene Stop:
389807

Gene Length:
1149

Molecular Weight*:
41777

pI*:
5.50

Net Charge*:
-10.23

EC:
6.1.1.21  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Histidine metabolism

Comment:
Oklahoma ID: NGO.397

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0185 (his2), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
NG0397 is orthologously related to AE002434, Neisseria meningitidis, strain MC58, a histidyl-tRNA synthetase protein: residues 1-383 are 98% similar to residues 1-383 of NG0397.

Several significant hits in gapped BLAST; e.g. residues 4-380 are 43% similar to gb|AAG08324.1|AE004907_2 conserved hypothetical protein of Pseudomonas aeruginosa, residues 1-320 are 26% similar to gb|AAC67293.1| histidyl-tRNA synthetase of Bacillus subtilis, residues 1-322 are 29% similar to gb|AAF11015.1|AE001989_3 histidyl-tRNA synthetase, putative of Deinococcus radiodurans.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0124
COG name: Histidyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0124 is amtkYQVCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-238 are 46% similar to a (HISX) protein domain (PD212190) which is seen in O30548_PSEST.



Paralogs:  Local Blast Search


NG0397 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
123  
229
non-globular  
261  
383

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYELVQPPLMEYAHS
LLTHIDAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSANQGIN
RLCYAGPVLHAQPDGLPNMREPLQAGAEMYGFADIRGDIELIDLMLKSMK
IADMGKVLLSLGHIGIFRALSDAAHLDAGQSAALLALMQDKDTGSVEAQV
KAWKLDGMWAKAFSLLPRLYGGREVLSDARGRLPDLSAVGGALDELQAVC
DAFPDNEIHIDLSELRVDNYHTGLLYAAYAADFHDAVARGGRYDGLGGYF
GRARPATGFSFDLRSFIGRLPAVERQPAVLVDAEDAEAAREAVEALREQG
QCVVIDYGIGHNVSEELAGRLKKTDGVWQVVKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGACATGGCAGCTTCCGGAACATATCGCCGACGTACTGCCCACGAA
CGCGCGGCAGCTTGAAAGCGCGCGCGAGCAGTTGTTGGCACTGTTCCGCG
TACACGGTTATGAACTGGTACAGCCTCCGCTGATGGAGTACGCACATTCC
CTGCTGACGCATATCGATGCGGGGCTTTCACTGAAAACCATTTTGGTAAC
GGACAGGCTCAGCGGCAGGCAGTTGGGCATACGCGCCGACATCACGCCGC
AGGTGGCGCGTATCGATGCCCATCTTTTGTCCGCCAACCAAGGGATTAAC
CGGTTGTGTTATGCCGGTCCGGTGTTGCACGCGCAGCCCGACGGTCTGCC
GAATATGCGCGAACCCTTGCAGGCAGGGGCGGAAATGTACGGTTTTGCCG
ACATCCGTGGCGACATCGAGCTGATAGACCTTATGCTGAAAAGCATGAAA
ATTGCCGATATGGGCAAAGTGCTGCTTTCGCTGGGGCATATCGGCATATT
CCGCGCCTTGTCCGATGCGGCGCATTTGGATGCGGGGCAGTCCGCAGCGC
TGCTTGCCTTGATGCAGGATAAAGATACCGGGTCGGTCGAAGCGCAGGTC
AAGGCTTGGAAGCTGGACGGTATGTGGGCAAAAGCATTCTCGCTGCTGCC
GCGCCTGTACGGCGGGCGTGAAGTGTTGTCCGACGCGCGCGGACGGTTGC
CGGATTTGTCGGCGGTCGGCGGCGCGTTGGACGAATTGCAGGCGGTGTGC
GACGCATTCCCCGATAATGAAATCCATATCGACTTGTCCGAGCTGCGCGT
CGACAATTACCACACGGGCTTGCTGTATGCCGCCTATGCCGCCGATTTCC
ACGACGCGGTCGCGCGCGGCGGGCGTTATGACGGATTGGGCGGATATTTC
GGCAGGGCGCGCCCGGCAACGGGATTCAGTTTCGACTTACGCAGCTTTAT
CGGGCGTTTGCCCGCCGTCGAACGGCAGCCCGCCGTGTTGGTCGATGCGG
AAGATGCAGAAGCGGCGCGCGAAGCGGTCGAAGCCTTGCGTGAACAAGGG
CAGTGTGTCGTGATTGACTACGGTATCGGACACAATGTTTCGGAAGAGCT
TGCAGGCCGTCTGAAAAAGACGGACGGCGTTTGGCAGGTCGTGAAACGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy