Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0328 IGR0325 IGR0324 IGR0329 IGR0326 IGR0330 IGR0327 IGR0323 IGR0331 IGR0332 IGR0333 NG0391 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 NG0395 NG0396 yfkO, - NG0388 hisZ,hisS, - NG0397 purA, - NG0398 NG0391 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 NG0395 NG0396 yfkO, - NG0388 hisZ,hisS, - NG0397 purA, - NG0398 NG0391 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 NG0395 NG0396 yfkO, - NG0388 hisZ,hisS, - NG0397 purA, - NG0398
* Calculated from Protein Sequence

Gene ID: NG0394

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murB  

Definition:
UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate dehydrogenase)

Gene Start:
386899

Gene Stop:
385862

Gene Length:
1038

Molecular Weight*:
38019

pI*:
7.10

Net Charge*:
0.52

EC:
1.1.1.158  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Pucci,M.J., Discotto,L.F. and Dougherty,T.J. 1992. Cloning and identification of the Escherichia coli murB DNA sequence, which encodes UDP-N-acetylpyruvylglucosamine reductase. J. Bacteriol. 174: 1690-1693. Medline: 92165747.


Comment:
Oklahoma ID: NGO.394c

For other 'mur' genes, see NG1500 (murI), NG1532 (murC), NG1533 (murG), NG1535 (murD), NG1539 (murF), NG1541 (murE), NG1918 (murA).

Blast Summary:  PSI-Blast Search
NG0394 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative UDP-N-acetylenolpyruvoylglucosamine reductase protein: residues 1-346 are 95% similar to residues 1-346 of NG0394.

Numerous significant hits in gapped BLAST; e.g. residues 9-341 are 50% similar to emb|CAB41011.1| UDP-N-acetylenolpyruvoylglucosamine reductase of Bordetella pertussis, residues 10-343 are 48% similar to dbj|BAB38322.1| UDP-N-acetylenolpyruvoylglucosamine reductase of Escherichia coli O157:H7, residues 10-343 are 47% similar to gb|AAA27163.1| UDP-N-acetylenolpyruvoylglucosamine reductase of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0812
COG name: UDP-N-acetylmuramate dehydrogenase
Functional Class:  M
The phylogenetic pattern of COG0812 is -----Qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003170 (UDP-N-acetylenolpyruvoylglucosamine reductase) with a combined E-value of 1.8e-86.
    IPB003170A    50-59
    IPB003170B    87-137
    IPB003170C    150-170
    IPB003170D    236-245
    IPB003170E    277-331


ProDom Summary:  Protein Domain Search
Residues 92-192 are 47% similar to a (UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE EC) protein domain (PD111573) which is seen in MURB_HAEIN.

Residues 210-340 are 54% similar to a (REDUCTASE UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE) protein domain (PD004983) which is seen in MURB_SALTY.



Paralogs:  Local Blast Search


NG0394 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 22 to 170 (E-value = 3.1e-05) place NG0394 in the FAD_binding_4 family which is described as FAD binding domain (PF01565)
Residues 214 to 341 (E-value = 5.5e-55) place NG0394 in the MurB_C family which is described as UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain (PF02873)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1MBT|1MBT OXIDOREDUCTASE288.0 8e-79
pdb|2MBR|2MBR MURB WILD TYPE, COMPLEX WITH 288.0 8e-79
pdb|1UXY|1UXY MURB MUTANT WITH SER 229 REPLACED BY ALA, COMPLEX287.0 2e-78
pdb|1HSK|1HSK-A CRYSTAL STRUCTURE OF S. AUREUS MURB

Gene Protein Sequence:
MQPIRYRTDLTPYNTFGLHAQARAFIALKHADELRDIVRLPEFDRDTVLW
LGGGSNILLMQDYDGLVVHMENKGIREIARSDGMVLIEAQAGEIWHDFVL
HTVALGLSGLENLSLIPGTVGASPVQNIGAYGVEAKDVIHSVRCFDLDTE
TFVTLSNADCRFAYRESLFKQEGKGRYVIVSVVFALKTHFVPNLGYGDLA
AKVAELSAGREATAKDVSDAVSAIRNSKLPDPKVLGNVGSFFKNPVVSAE
KAATLLQRHPDMPRYPQPDGSVKLAAGWLIDQCRLKGFQIGGAAVHDKQA
LVLVNKNNASANDVRQLAQHIKFTVFARFQVELHAEPNWLPTSFSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACCCATCCGATACCGAACCGACCTCACCCCCTACAACACTTTCGG
CCTGCACGCCCAAGCCCGGGCCTTTATCGCGCTTAAACACGCCGACGAAT
TGCGCGACATCGTCCGACTGCCCGAGTTCGACCGCGATACTGTTTTATGG
CTGGGCGGCGGCAGCAACATCCTTTTGATGCAGGATTACGACGGCTTGGT
CGTCCATATGGAAAACAAGGGCATACGCGAGATTGCGCGCTCAGACGGCA
TGGTTCTGATTGAAGCGCAGGCGGGCGAAATTTGGCACGATTTCGTGTTG
CACACCGTCGCGCTGGGTTTGAGCGGTTTGGAAAACCTGAGCCTGATTCC
GGGTACGGTCGGCGCGTCGCCCGTGCAGAACATCGGCGCATACGGCGTGG
AGGCGAAAGATGTGATTCACAGCGTGCGCTGCTTCGATTTGGATACGGAA
ACCTTTGTAACCCTTTCCAATGCCGACTGCCGCTTCGCCTACCGCGAAAG
CCTGTTCAAGCAGGAAGGCAAAGGGCGTTATGTGATTGTTTCGGTCGTAT
TTGCATTAAAAACGCATTTTGTGCCGAACTTGGGCTACGGCGATTTGGCG
GCGAAGGTTGCCGAATTGAGTGCAGGTAGGGAGGCAACGGCGAAAGACGT
TTCCGATGCGGTATCCGCCATCCGCAACAGCAAATTACCCGACCCGAAAG
TTTTGGGCAATGTCGGCAGTTTCTTTAAAAACCCCGTCGTCAGCGCGGAA
AAAGCCGCCACCCTGTTGCAGCGGCATCCCGATATGCCGCGCTATCCGCA
GCCCGACGGTTCGGTCAAACTCGCCGCCGGCTGGCTGATCGACCAATGCC
GTCTGAAGGGCTTCCAAATCGGCGGTGCGGCGGTACACGATAAACAGGCA
TTGGTTTTGGTAAACAAAAACAACGCCTCGGCAAACGATGTCCGGCAGTT
GGCGCAACACATCAAATTTACAGTATTTGCTCGGTTTCAGGTAGAATTAC
ACGCCGAACCCAATTGGCTGCCCACTTCGTTCAGCCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy