Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0328 IGR0325 IGR0324 IGR0329 IGR0326 IGR0327 IGR0323 IGR0320 IGR0318 IGR0319 IGR0322 IGR0321 NG0391 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 metC,metB2, - NG0386 NG0395 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 NG0391 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 metC,metB2, - NG0386 NG0395 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 NG0391 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 metC,metB2, - NG0386 NG0395 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385
* Calculated from Protein Sequence

Gene ID: NG0389

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rluD  

Definition:
RNA pseudouridylate synthase (RNA-binding protein)

Gene Start:
382815

Gene Stop:
382060

Gene Length:
756

Molecular Weight*:
28049

pI*:
10.60

Net Charge*:
16.07

EC:
4.2.1.70  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Wrzesinski J, Nurse K, Bakin A, Lane BG, Ofengand J.
A dual-specificity pseudouridine synthase: an Escherichia
coli synthase purified and cloned on the basis of its specificity for psi 746 in 23S RNA is also specific for psi 32 in tRNA(phe).
RNA 1995 Jun;1(4):437-48.
Medline: 96079974.

Comment:
Oklahoma ID: NGO.389c

For related genes, see NG0607, NG0642, NG0433, NG0278, NG0657, NG1811.

Blast Summary:  PSI-Blast Search
NG0389 is orthologously related to AE002434, Neisseria meningitidis, strain MC58, a conserved hypothetical protein: residues 1-252 are 96% similar to residues 1-252 of NG0389. NG0389 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative RNA-binding protein: residues 1-252 are 95% similar to residues 1-252 of NG0389.

Numerous significant hits in gapped BLAST; e.g. residues 15-250 are 46% similar to 13422112 RNA pseudouridylate synthase,
putative of Caulobacter crescentus, residues 15-250 are 37% similar to gb|AAF95367.1| pseudouridine synthase family 1 protein of Vibrio cholerae, residues 14-250 are 33% similar to gb|AAD35352.1|AE001708_20 16S pseudouridylate synthase of Thermotoga maritima.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1187
COG name: Predicted pseudouridylate synthase family 1
Functional Class:  J
The phylogenetic pattern of COG1187 is -----QvCEBrHuj--olinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB000748 (Pseudouridine synthase, Rsu family) with a combined E-value of 9.3e-39.
    IPB000748A    15-40
    IPB000748B    78-93
    IPB000748C    125-157
    IPB000748D    201-235
***** IPB000613 (Pseudouridine synthase) with a combined E-value of 3.3e-09.
    IPB000613B    125-164
    IPB000613C    205-229


ProDom Summary:  Protein Domain Search
Residues 181-250 are 40% similar to a (PROTEIN PSEUDOURIDINE SYNTHASE INTERGENIC REGION) protein domain (PD003862) which is seen in O84728_CHLTR.

Residues 15-80 are 47% similar to a (PROTEIN PSEUDOURIDINE SYNTHASE RIBOSOMAL) protein domain (PD004022) which is seen in YJBC_ECOLI.



Paralogs:  Local Blast Search


NG0389 is paralogously related to NG0657 (conserved hypothetical protein (possible pseudouridine synthase)) (2e-22) and NG0607 (ribosomal small subunit pseudouridine synthase A (16s pseudouridylate 516 synthase) (16s pseudouridine 516 synthase) (uracil hydrolyase)) (7e-17).


Pfam Summary:  Pfam Search
Residues 14 to 59 (E-value = 1.8e-08) place NG0389 in the S4 family which is described as S4 domain (PF01479)
Residues 73 to 217 (E-value = 1.7e-06) place NG0389 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
178  
252

PDB Hit:
pdb|1KSL|1KSL-A STRUCTURE 86.2 6e-18

Gene Protein Sequence:
MNSKISSDHTEDTIRLSKRMAQLGLCSRREADGHIEQGWVTVNGKTAVLG
QKVSPADRIELNKKAHEQQAARITILLNKPVGYVSAQAEKGYKSAAELIT
PENCWEGDTSRISFDPKHKIGLAPAGRLDIDSVGLLVLTQDGRIAKQLIG
ENSGSEKEYLVRVRGKLDEKGLALLNHGLSLDGDKLRPAKVEWQNEDQLR
FVLKQGKKRQIRRMCELVGLRVVGLKRIRMGKVKLGRLPPGKWRYLAPGE
SF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTCCAAAATTTCCTCCGACCATACAGAAGATACCATACGCCTCTC
CAAACGTATGGCACAACTGGGGCTTTGTTCGCGCCGCGAAGCCGACGGCC
ATATCGAACAGGGCTGGGTAACGGTCAACGGCAAAACCGCCGTACTCGGT
CAGAAAGTTTCACCGGCAGACCGTATCGAACTGAACAAGAAAGCCCACGA
ACAGCAGGCGGCACGCATTACCATCCTGCTGAACAAACCCGTCGGCTATG
TCAGCGCACAAGCGGAAAAAGGCTATAAATCCGCCGCCGAACTGATTACC
CCTGAAAATTGCTGGGAAGGCGACACCAGCCGCATCAGTTTCGATCCGAA
ACACAAAATCGGTCTTGCCCCCGCCGGCAGGCTCGATATCGATTCAGTCG
GATTGCTGGTGTTGACGCAAGACGGCCGTATCGCCAAGCAGCTTATCGGC
GAAAACAGCGGCAGTGAAAAAGAATATTTGGTGCGCGTGCGCGGCAAATT
GGACGAAAAAGGACTTGCCTTACTGAATCACGGATTGAGTTTGGACGGTG
ATAAACTGCGTCCCGCCAAAGTAGAATGGCAAAATGAAGACCAACTGCGC
TTCGTGTTGAAACAGGGTAAAAAGCGGCAAATCCGCCGTATGTGCGAACT
GGTCGGACTGCGCGTCGTCGGGCTGAAACGCATCCGCATGGGCAAGGTCA
AACTCGGCAGGCTGCCGCCCGGCAAATGGCGTTATCTCGCTCCCGGCGAA
TCGTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy