Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0328 IGR0325 IGR0324 IGR0326 IGR0327 IGR0323 IGR0317 IGR0320 IGR0318 IGR0319 IGR0322 IGR0321 NG0391 ftsJ,rrmJ, - NG0383 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 NG0391 ftsJ,rrmJ, - NG0383 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 NG0391 NG0393 rluD, - NG0389 NG0392 NG0390 murB, - NG0394 metC,metB2, - NG0386 ftsH,hflB, - NG0382 ftsJ,rrmJ, - NG0383 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385
* Calculated from Protein Sequence

Gene ID: NG0388

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yfkO  

Definition:
probable NAD(P)H-flavin oxidoreductase (possible NAD(P)H nitroreductase)

Gene Start:
381337

Gene Stop:
381999

Gene Length:
663

Molecular Weight*:
24809

pI*:
5.90

Net Charge*:
-1.70

EC:
1.6.6.-  

Functional Class:
Unassigned  

Pathway: pathway table
2,4-Dichlorobenzoate degradation

Comment:
Oklahoma ID: NGO.388

Blast Summary:  PSI-Blast Search
NG0388 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative NAD(P)H-flavin oxidoreductase protein: residues 1-221 are 96% similar to residues 1-221 of NG0388. NG0388 is orthologously related to AE002434, Neisseria meningitidis, strain MC58, a putative NAD(P)H nitroreductase protein: residues 1-221 are 96% similar to residues 1-221 of NG0388.

Numerous significant hits in gapped BLAST; e.g. residues 1-220 are 56% similar to gb|AAC22926.1| NAD(P)H-flavin oxidoreductase of Haemophilus influenzae Rd, residues 6-220 are 44% similar to pir||B69809 NAD(P)H-flavin oxidoreductase homolog yfkO of Bacillus subtilis, residues 4-211 are 40% similar to 6018239 NADPH-flavin oxidoreductase of Helicobacter pylori.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0778
COG name: Nitroreductase family proteins
Functional Class:  C
The phylogenetic pattern of COG0778 is AmT--qVcEBRHUJ-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000415 (Nitroreductase family) with a combined E-value of 1.8e-12.
    IPB000415A    44-56
    IPB000415B    152-170


ProDom Summary:  Protein Domain Search
Residues 115-220 are 55% similar to a (OXIDOREDUCTASE NAD NADP FLAVOPROTEIN) protein domain (PD009589) which is seen in YC78_HAEIN.

Residues 9-88 are 62% similar to a (PROTEIN OXIDOREDUCTASE FLAVOPROTEIN FMN) protein domain (PD001645) which is seen in YC78_HAEIN.



Paralogs:  Local Blast Search


NG0388 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 201 (E-value = 9.2e-54) place NG0388 in the Nitroreductase family which is described as Nitroreductase family (PF00881)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1NEC|1NEC-A NITROREDUCTASE FROM ENTEROBACTER CLOACAE 78.0 1e-15
pdb|1KQB|1KQB-A STRUCTURE OF NITROREDUCTASE FROM E. CLOACAE 78.0 1e-15
pdb|1DS7|1DS7-A A MINOR FMN-DEPENDENT NITROREDUCTASE FROM 74.5 2e-14
pdb|1VFR|1VFR-A THE

Gene Protein Sequence:
MTVLSKEQVLSAFKNRKSCRHYDAARKISAEDFQFILELGRLSPSSVGSE
PWQFVVVQNPEIRQAIKLFSWGMADALDTASHLVVFLAKKNARFDSPFML
ESLKRRGVTEPDAVEKSLARYQAFQADDIKILDDSRALFDWCCRQTYIAL
ANMMTGAAMAGIDSCPVEGFNYADMERVLSGQFGLFDAAEWGVSVAATFG
YRVQEIVTKARRPLEETVIWA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGTATTAAGCAAAGAGCAGGTTCTATCCGCATTTAAAAACCGCAA
ATCGTGCCGGCATTACGATGCGGCACGTAAAATCAGTGCCGAGGATTTTC
AGTTTATTTTAGAACTCGGGCGTTTGTCGCCCAGTTCGGTCGGTTCGGAG
CCTTGGCAGTTTGTTGTGGTTCAAAACCCCGAAATCCGACAGGCAATCAA
GCTGTTTTCTTGGGGTATGGCGGATGCTTTGGATACCGCCAGTCATTTGG
TGGTGTTTTTGGCGAAGAAAAATGCCCGCTTCGACAGCCCGTTTATGTTG
GAAAGTCTCAAACGGCGCGGCGTTACCGAACCGGATGCCGTAGAAAAATC
TTTGGCGAGGTATCAGGCGTTTCAAGCTGACGACATCAAGATTTTGGACG
ATTCGCGCGCCTTGTTTGACTGGTGCTGCCGCCAGACCTATATCGCGTTA
GCCAACATGATGACGGGTGCGGCGATGGCGGGTATCGATTCCTGCCCGGT
GGAAGGTTTCAACTATGCCGATATGGAACGCGTATTGTCCGGGCAGTTCG
GTTTGTTCGATGCGGCAGAATGGGGCGTGTCCGTTGCCGCGACATTCGGC
TACCGGGTTCAGGAAATCGTCACGAAAGCGCGCAGGCCCTTGGAAGAAAC
CGTTATTTGGGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy