Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0325 IGR0324 IGR0326 IGR0323 IGR0317 IGR0320 IGR0318 IGR0319 IGR0322 IGR0321 IGR0316 NG0391 ftsJ,rrmJ, - NG0383 rluD, - NG0389 NG0392 NG0390 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 NG0391 ftsJ,rrmJ, - NG0383 rluD, - NG0389 NG0392 NG0390 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 ftsJ,rrmJ, - NG0383 rluD, - NG0389 NG0392 NG0390 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0391 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385
* Calculated from Protein Sequence

Gene ID: NG0386

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
metC  metB2  

Definition:
probable cystathionine beta/gamma-lyase (probable cystathionine gamma-synthase)

Gene Start:
380164

Gene Stop:
379010

Gene Length:
1155

Molecular Weight*:
42243

pI*:
6.50

Net Charge*:
-5.18

EC:
4.2.99.9  4.4.1.1  4.4.1.8  

Functional Class:
Central intermediary metabolism; Sulfur metabolism  

Pathway: pathway table
Cysteine metabolism
Glycine, serine and threonine metabolism
Methionine metabolism
Nitrogen metabolism
Selenoamino acid metabolism
Sulfur metabolism

Secondary Evidence:
Dobric,N., Limsowtin,G.K., Hillier,A.J., Dudman,N.P. and
Davidson,B.E. 2000. Identification and characterization of a cystathionine beta/gamma-lyase from Lactococcus lactis ssp. cremoris MG1363(1). FEMS Microbiol. Lett. 182 (2): 249-254. Medline: 20088826.


Comment:
See also NG2027, methionine biosynthesis transcriptional regulator (MetR). In addition, other 'met' genes include: NG0928, metE; NG1149, metZ; NG0933, metX; NG0929, metF; NG0386, metC/metB2; and NG0106, metK, all involved in methionine biosynthesis.

Oklahoma ID: NGO.386c

Blast Summary:  PSI-Blast Search
NG0386 is orthologously related to AE002433, Neisseria meningitidis, strain MC58, a cystathionine gamma-synthase protein: residues 1-385 are 94% similar to residues 1-385 of NG0386. NG0386 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative carbon-sulphur lyase protein: residues 1-385 are 95% similar to residues 1-385 of NG0386.

Numerous significant hits in gapped BLAST; e.g. residues 5-382 are 46% similar to gb|AAF36088.1|AF170901_1 cystathionine beta/gamma-lyase of Lactococcus lactis subsp. cremoris, residues 1-382 are 43% similar to gb|AAB80859.1| cystathionine gamma-lyase of Bacillus subtilis, residues 1-380 are 44% similar to gb|AAD07176.1| cystathionine gamma-synthase of Helicobacter pylori 26695.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0626
COG name: Cystathionine beta-lyases/cystathionine gamma-synthases
Functional Class:  E
The phylogenetic pattern of COG0626 is ---kY-VcEBRHuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000277 (Cys/Met metabolism pyridoxal-phosphate-dependent enzymes) with a combined E-value of 1.3e-95.
    IPB000277A    41-62
    IPB000277B    135-168
    IPB000277C    172-207
    IPB000277D    229-269
    IPB000277E    327-343
    IPB000277F    360-377


ProDom Summary:  Protein Domain Search
Residues 5-382 are 39% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in O05394_BACSU.



Paralogs:  Local Blast Search


NG0386 is paralogously related to NG1149 (O-succinylhomoserine sulfhydrolase) (1e-50).


Pfam Summary:  Pfam Search
Residues 4 to 382 (E-value = 5.8e-154) place NG0386 in the Cys_Met_Meta_PP family which is described as Cys/Met metabolism PLP-dependent enzyme (PF01053)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
79  
176

PDB Hit:
pdb|1GC0|1GC0-A CRYSTAL STRUCTURE OF THE PYRIDOXAL-5'-PHOSPHATE 242.0 7e-65
pdb|1E5E|1E5E-A METHIONINE GAMMA-LYASE (MGL) FROM TRICHOMONAS 240.0 3e-64
pdb|1CS1|1CS1-A CYSTATHIONINE GAMMA-SYNTHASE (CGS) FROM 238.0 1e-63
pdb|1IBJ|1IBJ-A CRYS

Gene Protein Sequence:
MKFPTRTIHSGYDCDEHNRALMPPIYQNSMFALHEIGENVPYRYSRLSNP
TRQILEDTVADLEHGAAGFAFSSGMAGIDAVWRTFLRPGDTIVAVADIYG
GAYDLLVDVYQKWGVNVVFADLGNPDNLDELLKAHNVKLVWLEMPSNPLL
RLVDIKALAAKAKAADALVGIDNTFATPYLQQPLDMGCDFAFHSATKYLC
GHSDVLMGIVVAKTKELAQPLHDMMVHTGAIAGPTDCWLVLRGIKTLALR
MEAHCKNALEIARRLEAHPAIEKVFHPGLPSHEHYALAQAQMPKGIGGVV
TVYLKNDTREAANSVIKNMKLVKMTSSLGGVESLVNHCYSQSHSGVPHNV
KMEMGIRVGLLRFSIGIEDVDDIWNDISAALDTTL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTCCCGACCCGTACCATCCATTCCGGCTACGATTGCGACGAACA
CAACCGCGCGCTGATGCCGCCGATTTATCAAAACAGTATGTTTGCGCTGC
ACGAAATCGGCGAAAATGTGCCTTACCGTTATTCGCGCCTGAGCAACCCG
ACCCGTCAGATTTTGGAAGACACCGTTGCCGATTTGGAACACGGTGCGGC
AGGTTTTGCGTTTTCCAGCGGTATGGCGGGGATTGATGCCGTGTGGCGTA
CCTTCCTGCGCCCGGGCGATACCATCGTCGCGGTCGCCGATATTTACGGC
GGCGCATATGACTTATTGGTCGATGTTTATCAAAAATGGGGGGTGAACGT
TGTTTTTGCCGATTTGGGCAATCCCGATAATTTGGACGAATTGCTCAAAG
CGCACAATGTCAAACTGGTTTGGCTGGAAATGCCGTCCAATCCGCTTTTA
CGCTTGGTAGACATCAAAGCCCTTGCAGCGAAAGCCAAAGCAGCCGACGC
GCTGGTCGGCATCGACAACACCTTTGCCACGCCGTATCTGCAACAGCCCT
TGGATATGGGTTGCGATTTTGCATTCCATTCCGCTACCAAATATTTGTGC
GGCCATTCCGACGTATTGATGGGCATCGTCGTTGCCAAAACCAAAGAGCT
GGCTCAGCCTTTGCACGATATGATGGTGCATACCGGCGCGATTGCAGGTC
CGACGGACTGCTGGCTGGTGTTGCGCGGCATCAAAACGCTTGCCCTGCGT
ATGGAGGCACACTGCAAAAACGCACTCGAAATTGCGCGCCGTTTGGAAGC
CCATCCTGCCATTGAAAAAGTGTTCCATCCCGGCCTGCCGTCTCACGAAC
ATTACGCACTCGCCCAAGCGCAAATGCCCAAAGGCATCGGCGGCGTGGTT
ACGGTTTATCTCAAAAACGACACGCGCGAAGCGGCAAACAGCGTGATTAA
AAACATGAAACTGGTCAAAATGACCTCCAGCCTCGGCGGCGTGGAAAGTC
TGGTCAACCATTGCTATTCCCAATCTCACAGCGGCGTGCCGCATAATGTG
AAAATGGAAATGGGCATCAGGGTCGGACTCCTGCGCTTCTCCATCGGTAT
TGAAGACGTAGATGATATTTGGAACGATATTTCCGCCGCACTCGATACAA
CTTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy