Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0324 IGR0315 IGR0323 IGR0317 IGR0320 IGR0318 IGR0319 IGR0322 IGR0321 IGR0316 NG0381 pth, - NG0379 ftsJ,rrmJ, - NG0383 rluD, - NG0389 NG0390 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 NG0381 pth, - NG0379 ftsJ,rrmJ, - NG0383 rluD, - NG0389 NG0390 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 pth, - NG0379 ftsJ,rrmJ, - NG0383 rluD, - NG0389 NG0390 metC,metB2, - NG0386 ftsH,hflB, - NG0382 NG0380 NG0381 NG0380 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385
* Calculated from Protein Sequence

Gene ID: NG0385

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemB  

Definition:
delta-aminolevulinic acid dehydratase (porphobilinogen synthase)

Gene Start:
377927

Gene Stop:
378940

Gene Length:
1014

Molecular Weight*:
37238

pI*:
5.20

Net Charge*:
-7.58

EC:
4.2.1.24  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Frankenberg,N., Kittel,T., Hungerer,C., Romling,U. and Jahn,D. 1998.
Cloning, mapping and functional characterization of the hemB gene of Pseudomonas aeruginosa, which encodes a magnesium-dependent 5-aminolevulinic acid dehydratase.
Mol. Gen. Genet. 257 (4): 485-489.
Medline: 98190327.


Comment:
Oklahoma ID: NGO.385

For other 'hem' genes, see NG0234 and NG1580 (hemN), NG0293 (hemH), NG0360 (hemX), NG0362 (hemE), NG0040 (hemL), NG1318 (hemO), NG1403 (hemA), NG2015 (hemK).

Blast Summary:  PSI-Blast Search
NG0385 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative delta-aminolevulinic acid dehydratase protein: residues 1-338 are 98% similar to residues 1-338 of NG0385.

Numerous significant hits in gapped BLAST; e.g. residues 11-338 are 71% similar to 2495167 delta-aminolevulinic acid dehydratase (porphobilinogen synthase) (ALAD) (ALADH) of Pseudomonas aeruginosa, residues 14-336 are 68% similar to gb|AAF93283.1| delta-aminolevulinic acid dehydratase of Vibrio cholerae, residues 14-337 are 66% similar to gb|AAF85105.1|AE004042_4 delta-aminolevulinic acid dehydratase of Xylella fastidiosa.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0113
COG name: Delta-aminolevulinic acid dehydratase
Functional Class:  H
The phylogenetic pattern of COG0113 is amt-yq-cebr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001731 (Delta-aminolevulinic acid dehydratase) with a combined E-value of 4.2e-168.
    IPB001731A    17-49
    IPB001731B    57-92
    IPB001731C    122-144
    IPB001731D    150-204
    IPB001731E    229-281
    IPB001731F    291-329


ProDom Summary:  Protein Domain Search
Residues 33-329 are 72% similar to a (BIOSYNTHESIS DELTA-AMINOLEVULINIC ACID) protein domain (PD002304) which is seen in HEM2_PSEAE.



Paralogs:  Local Blast Search


NG0385 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 336 (E-value = 3.6e-190) place NG0385 in the ALAD family which is described as Delta-aminolevulinic acid dehydratase (PF00490)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
78  
94

PDB Hit:
pdb|1B4K|1B4K-A HIGH RESOLUTION CRYSTAL STRUCTURE OF A 442.0 0e+00
pdb|1GZG|1GZG-A COMPLEX OF A MG2-DEPENDENT PORPHOBILINOGEN 439.0 0e+00
pdb|1E51|1E51-A CRYSTAL STRUCTURE OF NATIVE HUMAN ERYTHROCYTE 230.0 3e-61
pdb|1L6S|1L6S-A CRYS

Gene Protein Sequence:
MIGGLMQFPYRNVPASRMRRMRRDDFSRRLMREHMLTADDLIYPVFVLEG
AAREEDVPSMPGVKRQSLDRLLFTAEEAVKLGIPMLALFPVVTANKTGRA
QEAYNPEGLVPSTVRALRERFSELGIMTDVALDPYTVHGQDGLTDENGYV
MNDETVEVLVKQALCHAEAGTQVVAPSDMMDGRIGAIREALEDAGHIHTR
IMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEALHEVAL
DIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAVAN
GWLDGGKVVLESLLAFKRAGADGILTYYAIEAAKMLKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGGAGGGCTTATGCAATTTCCTTACCGCAATGTTCCGGCTTCGCG
TATGCGCCGTATGCGCAGGGATGATTTTTCACGCCGCCTGATGCGCGAGC
ATATGCTGACCGCCGATGATTTGATTTATCCGGTGTTCGTATTGGAGGGG
GCGGCGCGCGAGGAGGATGTGCCTTCTATGCCGGGCGTGAAGCGTCAGAG
TTTGGACAGGCTGCTGTTTACGGCGGAAGAGGCGGTGAAGCTCGGTATTC
CGATGTTGGCACTCTTTCCCGTGGTTACGGCAAACAAAACCGGGCGTGCG
CAGGAGGCGTACAATCCCGAAGGACTCGTGCCGTCAACTGTCCGAGCCTT
GCGCGAGAGGTTTTCCGAACTGGGCATTATGACGGATGTCGCGCTCGATC
CTTATACGGTGCACGGTCAGGACGGACTGACGGACGAAAACGGTTACGTG
ATGAATGATGAAACCGTAGAAGTCTTGGTGAAACAGGCTTTATGTCATGC
AGAGGCGGGCACGCAGGTCGTTGCTCCTTCCGATATGATGGACGGGCGTA
TCGGCGCCATCCGCGAGGCTTTGGAGGATGCCGGACATATCCATACGCGG
ATTATGGCATATTCCGCCAAATATGCTTCTGCATTCTACGGCCCTTTCCG
TGATGCGGTAGGCAGTTCGGGCAATTTGGGAAAGGCAGATAAAAAGACCT
ATCAGATGGATCCTGCAAATACCGATGAGGCGCTGCATGAAGTGGCGCTC
GATATTCAGGAAGGTGCGGATATGGTGATGGTGAAGCCCGGTTTGCCGTA
TTTGGACGTTGTCCGCCGCGTGAAGGACGAGTTCGGCGTACCGACTTATG
CCTATCAGGTTTCGGGCGAATATGCGATGTTGCAGGCGGCGGTTGCCAAC
GGCTGGCTGGACGGCGGCAAAGTGGTTTTGGAAAGCCTGCTGGCATTCAA
ACGTGCGGGTGCGGACGGGATTTTGACCTATTACGCCATTGAGGCGGCAA
AGATGCTGAAGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy