Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0313 IGR0315 IGR0323 IGR0317 IGR0320 IGR0318 IGR0319 IGR0322 IGR0321 IGR0316 IGR0314 NG0378 NG0381 pth, - NG0379 ftsJ,rrmJ, - NG0383 metC,metB2, - NG0386 NG0377 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 NG0378 NG0381 pth, - NG0379 ftsJ,rrmJ, - NG0383 metC,metB2, - NG0386 NG0377 ftsH,hflB, - NG0382 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385 pth, - NG0379 ftsJ,rrmJ, - NG0383 metC,metB2, - NG0386 NG0377 ftsH,hflB, - NG0382 NG0380 NG0381 NG0378 NG0380 NG0384 yfkO, - NG0388 NG0387 hemB, - NG0385
* Calculated from Protein Sequence

Gene ID: NG0383

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ftsJ  rrmJ  

Definition:
cell division protein; heat shock protein; rRNA methyltransferase

Gene Start:
377364

Gene Stop:
376747

Gene Length:
618

Molecular Weight*:
22711

pI*:
8.10

Net Charge*:
1.87

EC:
2.1.1.-  

Functional Class:
Cellular processes; Cell division  
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Caldas T, Binet E, Bouloc P, Costa A, Desgres J, Richarme G.
The FtsJ/RrmJ heat shock protein of Escherichia coli is a 23 S ribosomal RNA methyltransferase.
J Biol Chem. 2000 Jun 2;275(22):16414-9.
PMID: 1074805

Tan J, Jakob U, Bardwell JC.
Overexpression of two different GTPases rescues a null mutation in a heat-induced rRNA methyltransferase.
J Bacteriol. 2002 May;184(10):2692-8.
PMID: 11976298

Hager J, Staker BL, Bugl H, Jakob U.
Active site in RrmJ, a heat shock-induced methyltransferase.
J Biol Chem. 2002 Nov;277(44):41978-86.
PMID: 12181314

Bügl H, Fauman EB, Staker BL, Zheng F, Kushner SR, Saper MA, Bardwell JC, Jakob U.
RNA methylation under heat shock control.
Mol Cell. 2000 Aug;6(2):349-60.
PMID: 10983982

Comment:
Oklahoma ID: NGO.383c

For other 'fts' genes, see NG0382 (ftsH), NG2060 (ftsY), NG0590 (ftsK), NG0851 (ftsK), NG1528 (ftsZ), NG1529 (ftsA), NG1530 (ftsQ), NG1534 (ftsW), NG1921 (ftsX), NG1922 (ftsE). See also NG1543 (ftsL related).

Blast Summary:  PSI-Blast Search
NG0383 is orthologously related to AE002433, Neisseria meningitidis, strain MC58, a cell division protein (FtsJ): residues 1-206 are 98% similar to residues 1-206 of NG0383.

Numerous significant hits in gapped BLAST; e.g. residues 4-206 are 55% similar to 12230965 ribosomal RNA large subunit methyltransferase J (rRNA (uridine-2'-O-)-methyltransferase) (23s rRNA M2U2552 methyltransferase) (cell division protein FtsJ homolog) of Pseudomonas aeruginosa, residues 5-201 are 52% similar to gb|AAF93802.1| cell division protein FtsJ of Vibrio cholerae, residues 5-205 are 52% similar to gb|AAF82907.1|AE003863_9 cell division protein of Xylella fastidiosa, residues 4-206 are 47% similar to pir||S35108 rRNA methyltransferase of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0293
COG name: Methyltranferase FtsJ involved in cell division
Functional Class:  D
The phylogenetic pattern of COG0293 is amt-Y---e--h----ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002877 (FtsJ cell division protein) with a combined E-value of 7.4e-51.
    IPB002877A    18-41
    IPB002877B    53-66
    IPB002877C    117-134
    IPB002877D    162-202


ProDom Summary:  Protein Domain Search
Residues 18-206 are 46% similar to a (PROTEIN CELL DIVISION FTSJ) protein domain (PD003907) which is seen in FTSJ_ECOLI.



Paralogs:  Local Blast Search


NG0383 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 29 to 206 (E-value = 4.4e-65) place NG0383 in the FtsJ family which is described as FtsJ-like methyltransferase (PF01728)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1EIZ|1EIZ-A FTSJ RNA METHYLTRANSFERASE COMPLEXED WITH S- 169.0 3e-43

Gene Protein Sequence:
MAVRSKSSKAWLHEHINDQYVHMAQKDGYRARAAYKLLEINEKDKIIKPG
TVLADLGSAPGSWSQVAAKLTGTSGAVFALDILPMEAIGGVSFIQGDFRE
NDVLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFAS
QHLKTGGSFLVKVFQGAGYQEYMAAMREIFGTVQTRKPEASRNRSSEIYL
LGKNKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGTACGTTCCAAATCCTCAAAAGCGTGGCTGCACGAACACATCAA
CGACCAGTACGTCCATATGGCGCAAAAAGACGGCTACCGCGCCCGTGCCG
CATACAAACTTTTGGAAATCAACGAAAAAGACAAGATAATCAAACCCGGC
ACGGTACTTGCCGACTTGGGCAGCGCGCCGGGAAGCTGGTCGCAGGTTGC
CGCCAAGCTGACGGGTACTTCCGGAGCGGTTTTCGCCTTGGACATCCTGC
CTATGGAAGCCATAGGGGGCGTGTCCTTCATTCAGGGCGACTTCCGCGAG
AACGACGTTTTGGCGCAATTCGAAACCTTGTTGGACAACCGCCCGCTCGA
CCTTGTAATCTGCGATATGGCGCCCAATATGTCGGGAAACGCCGTAAGCG
ATCAGGCACGCAGCTTTTATCTGTGCGAACTGGCTTTGGACTTCGCCTCG
CAACACCTGAAAACCGGCGGCAGCTTTTTGGTCAAAGTCTTTCAGGGTGC
AGGCTATCAGGAATACATGGCAGCCATGCGCGAAATTTTCGGCACTGTGC
AGACGCGCAAACCCGAAGCCTCGCGCAATCGCTCCAGTGAGATTTATTTA
TTGGGCAAAAATAAACGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy