Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0309 IGR0313 IGR0315 IGR0310 IGR0312 IGR0311 IGR0316 IGR0314 IGR0308 NG0378 NG0381 ppiB, - NG0376 pth, - NG0379 NG0371 pgm, - NG0375 NG0377 ftsH,hflB, - NG0382 glnQ, - NG0374 NG0372 NG0378 NG0381 ppiB, - NG0376 pth, - NG0379 NG0371 pgm, - NG0375 NG0377 ftsH,hflB, - NG0382 glnQ, - NG0374 NG0372 NG0378 ppiB, - NG0376 pth, - NG0379 NG0371 pgm, - NG0375 NG0377 ftsH,hflB, - NG0382 NG0380 NG0381 NG0380 glnQ, - NG0374 NG0372 NG0373 NG0373
* Calculated from Protein Sequence

Gene ID: NG0376

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ppiB  

Definition:
peptidyl-prolyl cis-trans isomerase B (rotamase B)

Gene Start:
370768

Gene Stop:
370262

Gene Length:
507

Molecular Weight*:
18865

pI*:
4.90

Net Charge*:
-6.80

EC:
5.2.1.8  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Hayano,T., Takahashi,N., Kato,S., Maki,N. and Suzuki,M. 1991. Two distinct forms of peptidylprolyl-cis-trans-isomerase are
expressed separately in periplasmic and cytoplasmic compartments of Escherichia coli cells.
Biochemistry (N.Y.) 30 (12): 3041-3048. Medline: 91175755.

Compton,L.A., Davis,J.M., Macdonald,J.R. and Bachinger,H.P. 1992. Structural and functional characterization of Escherichia coli
peptidyl-prolyl cis-trans isomerases.
Eur. J. Biochem. 206 (3): 927-934. Medline: 92299023.


Comment:
See also ppiA (NG0544) and ppiD (NG0766).

Oklahoma ID: NGO.376c

Blast Summary:  PSI-Blast Search
NG0376 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative peptidyl-prolyl cis-trans isomerase B protein: residues 1-169 are 97% similar to residues 1-169 of NG0376.

Numerous significant hits in gapped BLAST; e.g. residues 1-163 are 70% similar to gb|AAC21754.1| peptidyl-prolyl cis-trans isomerase B of Haemophilus influenzae Rd, residues 1-163 are 63% similar to gb|AAF94997.1| peptidyl-prolyl cis-trans isomerase B of Vibrio cholerae, residues 1-163 are 58% similar to gb|AAC73627.1| peptidyl-prolyl cis-trans isomerase B (rotamase B) of Escherichia coli K12.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0652
COG name: Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family
Functional Class:  O
The phylogenetic pattern of COG0652 is --t-Y--CEbRhuj---l---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002130 (Cyclophilin-type peptidyl-prolyl cis-trans isomerase) with a combined E-value of 1.2e-33.
    IPB002130A    9-30
    IPB002130B    36-74
    IPB002130C    84-121


ProDom Summary:  Protein Domain Search
Residues 1-44 are 75% similar to a (ISOMERASE ROTAMASE PEPTIDYL-PROLYL) protein domain (PD002184) which is seen in CYPB_HAEIN.

Residues 45-163 are 60% similar to a (ISOMERASE ROTAMASE CIS-TRANS CYCLOPHILIN PEPTIDYL-PROLYL) protein domain (PD000341) which is seen in CYPB_HAEIN.



Paralogs:  Local Blast Search


NG0376 is paralogously related to NG0544 (peptidyl-prolyl cis-trans isomerase A protein) (4e-37).


Pfam Summary:  Pfam Search
Residues 1 to 169 (E-value = 1.7e-56) place NG0376 in the Pro_isomerase family which is described as Cyclophilin type peptidyl-prolyl cis-trans isomerase (PF00160)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|2NUL|2NUL PEPTIDYLPROLYL ISOMERASE FROM E. COLI 170.0 2e-43
pdb|1LOP|1LOP-A CYCLOPHILIN A COMPLEXED WITH 170.0 2e-43
pdb|1CLH|1CLH CYCLOPHILIN (NMR, 12 STRUCTURES) 149.0 3e-37
pdb|1QOI|1QOI-A U4/U

Gene Protein Sequence:
MIILHTNKGDIKIELDFDKAPVTAKNFEQYVKDGFYDGVIFHRVIKGFMI
QGGGMDENMNEKETRDPIQNEASNGLPNDKYTIAMARTSDPHSAGAQFFI
NTADNAFLNFRSKELYGKTVVQDWGYAVFGKVVDGFDVVDAIESVSTKRH
GYHDDVPTEPVIIIKAEAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATCCTGCACACCAACAAAGGCGACATCAAAATCGAACTCGATTT
CGACAAAGCCCCTGTTACCGCCAAAAACTTCGAGCAATACGTCAAAGACG
GCTTCTACGACGGCGTAATCTTCCACCGCGTCATCAAAGGCTTCATGATT
CAAGGCGGCGGCATGGATGAAAACATGAACGAAAAAGAAACCCGCGATCC
GATTCAAAACGAAGCGTCCAACGGCCTGCCCAACGATAAATACACCATCG
CCATGGCGCGCACTTCCGACCCCCATTCCGCCGGCGCGCAATTCTTCATC
AACACTGCCGACAACGCTTTCCTAAACTTCCGTTCTAAAGAGCTGTACGG
CAAAACCGTCGTCCAAGACTGGGGCTATGCCGTATTCGGTAAAGTCGTTG
ACGGTTTTGACGTTGTCGATGCCATCGAAAGCGTATCCACCAAACGCCAC
GGCTACCACGACGATGTGCCGACCGAACCTGTCATCATCATTAAAGCCGA
AGCAGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy