Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0309 IGR0303 IGR0307 IGR0304 IGR0306 IGR0305 IGR0308 NG0368 NG0371 dcmG, - NG0365 recB, - NG0370 NG0366 glnQ, - NG0374 NG0372 sms,radA, - NG0367 NG0368 NG0371 dcmG, - NG0365 recB, - NG0370 NG0366 glnQ, - NG0374 NG0372 sms,radA, - NG0367 Type: tandem, Name:  - 17 NG0368 NG0371 dcmG, - NG0365 recB, - NG0370 pspE, - NG0369 pspE, - NG0369 NG0366 NG0372 sms,radA, - NG0367 NG0373 NG0373 glnQ, - NG0374
* Calculated from Protein Sequence

Gene ID: NG0370

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recB  

Definition:
exodeoxyribonuclease V beta chain (DNA helicase, ATP-dependent dsDNA/ssDNA exonuclease V subunit, ssDNA endonuclease)

Gene Start:
365085

Gene Stop:
361486

Gene Length:
3600

Molecular Weight*:
134268

pI*:
5.70

Net Charge*:
-21.29

EC:
3.1.11.5  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Finch,P.W., Storey,A., Chapman,K.E., Brown,K., Hickson,I.D. and
Emmerson,P.T. 1986. Complete nucleotide sequence of the Escherichia coli recB gene. Nucleic Acids Res. 14 (21): 8573-8582. Medline: 87066729.


Comment:
Oklahoma ID: NGO.370c

From GenBANK (gi:2507018): This enzyme complex exhibits several catalytic activities, including ATP-dependent exonuclease, ATP-stimulated endonuclease, ATP-dependent unwinding and DNA-dependent ATPase activities. Strand cleavage occurs 5' to 3' during the unwinding of duplex DNA at chi sequences, which locally stimulate recombination. It also performs exonucleolytic cleavage (in the presence of atp) in either 5'-to 3'-or 3'-to 5'-direction to yield 5'-phosphooligonucleotides. It consist of three subunits; recB, recC and recD.

For the alpha and gamma chains, see NG0771 and NG1369.

For all other 'rec' genes, see NG0318 (recN), NG0117 (recG), NG0414 (recJ), NG0741 (recA), NG0767 (recR), NG0771 (recD), NG1053 (recX), NG1369 (recC), NG1509 (recO), NG1722 (recQ).

Blast Summary:  PSI-Blast Search
NG0370 is orthologously related to AE002432, Neisseria meningitidis, strain MC58, a exodeoxyribonuclease V 135 KD polypeptide: residues 1-1204 are 94% similar to residues 1-1200 of NG0370. NG0370 is orthologously related to AL162754, Neisseria
meningitidis, strain Z2491, a putative exodeoxyribonuclease V beta chain protein: residues 1-1204 are 94% similar to residues 1-1200 of NG0370.

Numerous significant hits in gapped BLAST; e.g. residues 9-1199 are 30% similar to gb|AAF95464.1| exodeoxyribonuclease V, 135 kDa subunit of Vibrio cholerae, residues 9-1182 are 31% similar to gb|AAC22966.1| exodeoxyribonuclease V, beta chain of Haemophilus influenzae Rd, residues 1-1180 are 31% similar to gb|AAC75859.1| DNA helicase, ATP-dependent dsDNA/ssDNA exonuclease V subunit, ssDNA endonuclease of Escherichia coli K12.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1074
COG name: ATP-dependent exoDNAse (exonuclease V), beta subunit, - helicase and exonuclease domains
Functional Class:  L
The phylogenetic pattern of COG1074 is --------ebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000212 (UvrD/REP helicase) with a combined E-value of 4.2e-52.
    IPB000212A    23-33
    IPB000212B    51-68
    IPB000212C    406-417
    IPB000212D    434-447
    IPB000212E    465-483
    IPB000212F    751-769
    IPB000212G    816-828


ProDom Summary:  Protein Domain Search
Residues 980-1180 are 35% similar to a (EXODEOXYRIBONUCLEASE V BETA EXONUCLEASE CHAIN HYDROLASE) protein domain (PD024877) which is seen in EX5B_ECOLI.

Residues 742-938 are 34% similar to a (EXODEOXYRIBONUCLEASE V BETA CHAIN) protein domain (PD136866) which is seen in EX5B_HAEIN.

Residues 739-827 are 41% similar to a (HELICASE DNA ATP-BINDING DNA-BINDING II ATP-DEPENDENT) protein domain (PD002094) which is seen in EX5B_ECOLI.

Residues 20-75 are 51% similar to a (HELICASE PROTEIN ATP-BINDING DNA DNA-BINDING) protein domain (PD000627) which is seen in EX5B_ECOLI.

Residues 18-213 are 28% similar to a (RECB) protein domain (PD211733) which is seen in P96920_MYCTU.

Residues 363-479 are 51% similar to a (HELICASE DNA ATP-BINDING DNA-BINDING ATP-DEPENDENT) protein domain (PD001658) which is seen in P96920_MYCTU.

Residues 127-186 are 51% similar to a (EXODEOXYRIBONUCLEASE V EXONUCLEASE BETA) protein domain (PD024187) which is seen in EX5B_HAEIN.

Residues 490-729 are 29% similar to a (EXODEOXYRIBONUCLEASE V EXONUCLEASE BETA CHAIN HYDROLASE) protein domain (PD024188) which is seen in EX5B_HAEIN.



Paralogs:  Local Blast Search


NG0370 is paralogously related to NG1757 (probable DNA helicase II) (2e-10) and NG0739 (ATP-dependent DNA helicase) (2e-10).


Pfam Summary:  Pfam Search
Residues 3 to 721 (E-value = 2e-53) place NG0370 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
99
coil-coil  
321  
370
coil-coil  
792  
831

PDB Hit:
pdb|1UAA|1UAA-A STRUCTURE OF THE REP HELICASE-SINGLE STRANDED 71.4 9e-13
pdb|1QHG|1QHG-A 57.8 1e-08
pdb|2PJR|2PJR-A HELICASE PRODUCT COMPLEX 44.1 1e-04
pdb|1QHH|1QHH-B STRUCTURE OF DNA HELICASE WITH ADPNP 4

Gene Protein Sequence:
MSAPIRAFDPLTAPISGTNLIEASAGTGKTYGIAALFTRLIVLEQKSVER
VLVVTFTKAATAELKTRLRARLDDVLQVLESKEIAELGDDTLSDGIAAYC
AEHHEGDTFLPALLEQALQKESRTRLIVRLKAAIGQFDNAAIYTIHGFCQ
RILRDYAFLCQAPFDVELTEEDGDRLLVPAQDFWRERVSGDPVLAALAFK
RKAVPQTVLAQIRAYLSRPYLNFRRPQADLKQAQRDAETSWQTVCRLLPE
LEAGFWRIHPDLNGNSYRKNSFGNLFKELAQKSAAGQLPCLDKDTHERLL
KLSSDKLEAGLKKGKTPDAAVFAELQKLADFGRDLNALEEAEETTMIRLQ
LDLIEYLNSSLAEMKKSRRERGFDDLLLDVHTALTDNPHAETPARAVAEN
WEIALIDEFQDTDPLQYEIFQKIFIARNRPLFLVGDPKQAIYSFRGADIY
AYLQAAEDARHRYTLATNYRSHAALIGSIGALFRLKERPFVLENIGYSEV
GAARAESRLSPKRPAVQLRWLHENDNEKANKDVLRRRAADYCADEIARAL
NEASGGRLNFKDRPLQSGDIAVLVRTHNEAVMISAALKKRQVQSVLLSRE
SVFASPEAAALSALIGFWLEPRRAGTLRFVLTSGIFGYDAQQLHDFNQNE
SEILHWAESARTALDIWQKYGIFAAMQQFSQTHGIETRLLSRNNGRSLTN
YFQLLELLAAEDAQNRNPAALHKWLRDQISLAGNNGGDNRAIRLESDEDL
VKIVTMHASKGLQYPLVYCPFAWDAQDTGPSDWQILHQGANRAELLAKAQ
LSESEQKQYADEEMAERLRLLYVALTRAEEQLNIYAAYSSDTADNPLAYL
IEGLPQDSRETVRRTYACEKDGITMLKRNWRRVADNAPAGTDFTFTEDAP
PPAAYRGNADQAAEFAANSIPERGFRFVRHTSFTALSRHTQTPDGGEEDA
CPSLDAAETSVPAMPSETPTASDGISIHDFPKGTQAGLCLHEILEDFKFG
QAAAEQETLIADKLKKYGFEEIWLPAVAEMAEACRKTPLTGAYGLSDIPP
GCRRPEMGFTLHTEDFGLKRLRDWLARDDIRLPEVCRAAAETLDFHTVNG
FLNGFIDMVCQDPDGNICIIDYKSNHLSAYTRQAMDEAVAHQHYYLQALI
YAVAAARYFKLRGQPPAAVSVRYLFLRGLDGKGGGVWRWDIDAAALEQIK


Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGCACCCATCCGAGCATTCGACCCGCTGACCGCCCCCATTTCCGG
CACCAACCTGATTGAGGCCTCTGCCGGCACCGGCAAAACCTACGGCATTG
CCGCCCTGTTTACGCGCCTGATCGTATTGGAACAAAAAAGCGTCGAGCGC
GTATTGGTCGTTACCTTCACCAAAGCCGCCACTGCCGAGCTGAAAACACG
CCTGCGCGCGCGTTTGGACGATGTGTTGCAGGTTTTGGAAAGCAAAGAAA
TTGCCGAACTTGGAGACGACACGCTTTCAGACGGCATTGCCGCCTACTGC
GCCGAACACCACGAAGGCGACACCTTCCTGCCCGCACTCTTGGAACAGGC
TTTGCAAAAAGAAAGCCGGACGCGTCTGATTGTCCGCCTCAAGGCCGCCA
TCGGGCAATTCGACAACGCCGCCATCTACACCATCCACGGCTTCTGCCAG
CGCATCCTGCGCGACTACGCCTTCCTGTGCCAAGCACCGTTCGATGTCGA
ACTGACCGAAGAAGACGGCGACCGCCTGCTTGTCCCGGCTCAAGATTTTT
GGCGGGAACGCGTCAGCGGCGACCCGGTGCTTGCCGCATTGGCGTTTAAA
CGCAAAGCTGTGCCGCAAACCGTCCTTGCCCAAATCCGCGCCTACCTGTC
CCGCCCGTACCTGAATTTCCGCCGTCCGCAGGCGGATTTGAAACAGGCGC
AGCGCGACGCCGAAACCTCATGGCAAACCGTCTGCCGCCTGCTGCCCGAG
CTGGAAGCCGGCTTTTGGCGCATCCATCCCGACCTCAACGGCAACAGTTA
CCGCAAAAACAGCTTCGGCAACCTTTTTAAAGAACTGGCACAAAAATCCG
CCGCCGGACAACTGCCCTGTCTGGACAAAGACACGCACGAACGGCTCTTG
AAACTCTCATCCGACAAACTTGAAGCCGGACTGAAAAAAGGCAAAACGCC
CGATGCGGCAGTATTTGCCGAATTGCAGAAACTGGCAGACTTCGGGCGCG
ATTTGAACGCACTCGAAGAAGCGGAAGAAACAACAATGATCCGGCTGCAA
CTGGATTTAATCGAATATCTCAACAGCAGCCTTGCCGAAATGAAAAAATC
GCGCCGCGAACGCGGTTTCGACGACCTGCTGCTCGATGTCCACACCGCGC
TGACCGACAATCCGCACGCCGAAACCCCCGCCCGCGCCGTTGCCGAAAAC
TGGGAAATCGCGCTGATCGACGAGTTCCAAGACACCGACCCGCTGCAATA
CGAAATCTTCCAAAAGATTTTCATCGCCCGAAACCGCCCGCTGTTCCTCG
TCGGCGACCCCAAACAGGCGATTTACAGCTTTCGCGGTGCGGACATTTAC
GCCTACCTTCAGGCGGCGGAAGACGCGCGGCACCGCTACACGCTCGCCAC
CAACTACCGCAGCCACGCCGCGCTTATCGGCAGCATCGGCGCGCTGTTCC
GCCTCAAAGAACGCCCGTTCGTTTTGGAAAACATCGGCTATTCGGAAGTC
GGTGCGGCGCGTGCCGAAAGCAGGTTGTCGCCCAAACGTCCTGCCGTACA
GCTCCGTTGGCTGCACGAAAACGACAATGAAAAAGCCAACAAAGACGTTT
TGCGCCGCCGTGCCGCCGACTATTGCGCCGACGAAATCGCCCGCGCGCTC
AACGAAGCCTCCGGAGGCCGTCTGAATTTCAAAGACCGCCCGTTGCAGTC
GGGCGATATTGCCGTTCTGGTACGCACGCACAACGAGGCGGTGATGATTT
CCGCCGCACTGAAAAAACGGCAGGTGCAAAGCGTCCTGCTTTCGCGCGAA
TCCGTGTTCGCCTCGCCCGAAGCCGCCGCCCTGTCCGCGCTCATCGGCTT
CTGGCTCGAACCGCGCCGCGCCGGAACGCTGCGCTTTGTCCTGACAAGCG
GCATATTCGGTTATGACGCGCAGCAATTGCACGACTTCAACCAAAACGAA
AGCGAGATTTTGCATTGGGCGGAATCTGCCCGAACCGCGCTCGACATATG
GCAAAAATACGGCATTTTCGCCGCTATGCAGCAGTTTTCCCAAACACACG
GCATCGAAACGCGCCTCTTAAGCCGGAACAACGGGCGCAGCCTGACCAAT
TATTTCCAACTGCTCGAACTGCTTGCCGCCGAAGACGCGCAAAACCGCAA
CCCCGCCGCACTGCACAAATGGCTGCGCGATCAAATCAGCCTGGCCGGCA
ACAACGGCGGCGACAACCGCGCCATCCGTTTGGAAAGCGACGAAGATTTG
GTCAAAATCGTTACCATGCACGCCTCGAAAGGTTTGCAGTATCCGCTGGT
GTACTGCCCGTTTGCGTGGGACGCGCAAGATACCGGACCGTCCGACTGGC
AAATCCTCCACCAAGGCGCAAACCGGGCCGAACTTTTGGCAAAGGCGCAA
CTGTCGGAAAGCGAACAGAAGCAATACGCCGACGAAGAAATGGCGGAACG
CCTGCGCCTGCTTTATGTCGCGCTGACGCGTGCCGAGGAACAGCTCAACA
TCTACGCCGCCTATTCTTCCGATACCGCCGACAACCCCCTCGCCTACCTG
ATCGAAGGCTTGCCGCAAGACAGCCGCGAAACCGTCCGCCGTACCTATGC
GTGTGAAAAAGACGGCATAACGATGCTCAAACGCAACTGGCGGCGCGTGG
CGGACAATGCCCCGGCCGGCACGGATTTCACCTTCACAGAAGATGCGCCG
CCCCCTGCCGCCTATCGCGGCAACGCCGATCAAGCCGCCGAATTTGCCGC
AAACAGCATTCCCGAACGCGGATTCCGATTTGTCCGCCACACCAGCTTTA
CCGCCTTAAGCCGCCATACCCAAACGCCCGACGGCGGCGAAGAAGATGCC
TGCCCGTCCTTGGATGCCGCCGAAACCTCGGTGCCGGCGATGCCGTCTGA
AACGCCGACGGCTTCAGACGGCATATCGATACACGACTTTCCGAAAGGCA
CGCAGGCGGGGCTGTGCCTGCACGAAATTCTTGAAGATTTCAAATTCGGA
CAAGCAGCCGCCGAACAGGAAACCCTCATTGCCGACAAGCTGAAAAAATA
CGGTTTTGAAGAAATATGGCTGCCCGCCGTTGCCGAAATGGCGGAAGCCT
GCCGCAAAACGCCGCTGACTGGGGCATACGGCCTGTCCGACATCCCGCCC
GGGTGCCGCCGTCCCGAAATGGGCTTTACCCTCCACACCGAAGACTTCGG
CCTCAAACGGCTGCGCGACTGGCTTGCCCGCGACGACATCAGGCTGCCCG
AAGTCTGCCGTGCCGCCGCCGAGACGCTCGACTTCCACACCGTCAACGGC
TTTTTAAACGGCTTTATCGATATGGTCTGCCAAGACCCCGACGGCAATAT
CTGCATCATCGACTACAAATCCAACCACCTATCCGCCTACACGCGGCAGG
CGATGGACGAAGCCGTCGCGCACCAGCACTATTACCTTCAGGCACTGATT
TACGCCGTTGCCGCCGCGCGCTACTTCAAACTGCGCGGACAACCGCCCGC
CGCCGTTTCCGTCCGCTACCTGTTTTTGCGCGGATTGGATGGCAAAGGCG
GCGGCGTTTGGCGTTGGGACATAGATGCCGCCGCTTTGGAACAGATAAAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy