Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0302 IGR0303 IGR0301 IGR0300 IGR0304 IGR0306 IGR0305 NG0368 dcrG, - NG0364 dcmG, - NG0365 NG0363 recB, - NG0370 NG0366 hemE, - NG0362 NG0361 hemX, - NG0360 sms,radA, - NG0367 NG0368 dcrG, - NG0364 dcmG, - NG0365 NG0363 recB, - NG0370 NG0366 hemE, - NG0362 NG0361 hemX, - NG0360 sms,radA, - NG0367 Type: tandem, Name:  - 17 NG0368 dcrG, - NG0364 dcmG, - NG0365 NG0363 pspE, - NG0369 recB, - NG0370 pspE, - NG0369 NG0366 hemE, - NG0362 NG0361 hemX, - NG0360 sms,radA, - NG0367
* Calculated from Protein Sequence

Gene ID: NG0364

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dcrG  

Definition:
restriction endonuclease NgoVII (type II restriction enzyme NgoFVII)

Gene Start:
357319

Gene Stop:
356285

Gene Length:
1035

Molecular Weight*:
39824

pI*:
7.40

Net Charge*:
2.15

EC:
3.1.21.-  3.1.21.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Stein,D.C., Gunn,J.S., Radlinska,M. and Piekarowicz,A. 1995. Restriction and modification systems of Neisseria gonorrhoeae. Gene 157 (1-2): 19-22. Medline: 95331562.


Comment:
For other 'dcr' genes see NG1992 (dcrA) and NG0874 (dcrD).


Oklahoma ID: NGO.364c

Blast Summary:  PSI-Blast Search
NG0364 is 97% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1165246.

No hit to N.meningitidis in gapped BLAST.

One significant hit in gapped BLAST; e.g. residues 1-337 are 31% similar to 1076011 stress-sensitive restriction system protein
1 of Corynebacterium glutamicum (ATCC 13032).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0364 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNTVFSNIANAKITEKSLNAVWMDLFKSADEVLMATGYVSNDAVVELHKI
LELNDHIQKIDLLVGMHYLEGFSHLQYDSLCKLNDFLRHEKRGAVYVSPF
VKFHGKMYSFKNYQKINGLIGSANLTCFWDSTERTYETMLHLNGKPAQIL
QADIQSTIHKLGKNIQEVERPSKFIEHNSHLENCLGVQKIAPEQIRQLFA
QTSEYHFSIPAKTEEKSNLNVFFGEGRRDKRGFVKPRPWYEVELIVSKDI
TSQEGYPVLKSFTVITDDGWQFQCKTSGDYSKNFRSENDLKTLGKWIKGR
LESHGCLQNNEKITHETLREYGNDHFELRSTDNPDVWLLSFKGKN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACAGTTTTTTCCAATATCGCCAATGCCAAAATCACTGAAAAATC
TCTTAATGCGGTTTGGATGGATTTATTTAAATCAGCGGATGAAGTGTTGA
TGGCGACAGGTTATGTATCTAATGACGCAGTGGTTGAGTTACATAAAATT
TTGGAGCTAAACGATCATATTCAAAAAATAGATTTATTGGTCGGAATGCA
TTATTTGGAAGGTTTTAGCCATTTACAATATGACAGCTTATGTAAACTAA
ATGATTTTTTGCGACATGAGAAAAGAGGAGCCGTCTATGTTTCCCCCTTT
GTGAAATTTCACGGCAAAATGTATTCCTTTAAAAATTATCAAAAAATCAA
TGGATTAATTGGTTCTGCTAACTTAACGTGTTTTTGGGATAGCACGGAAC
GTACTTATGAAACTATGTTGCATTTGAACGGTAAGCCTGCACAGATTTTG
CAGGCAGATATTCAAAGTACTATTCATAAGCTAGGCAAAAATATCCAAGA
AGTTGAAAGACCAAGTAAATTTATTGAACATAATAGCCATTTAGAAAATT
GTTTGGGTGTTCAGAAAATTGCACCAGAACAGATTCGGCAATTATTTGCC
CAAACGTCAGAATATCATTTCTCAATTCCAGCTAAAACCGAAGAAAAAAG
TAATTTGAATGTATTTTTTGGAGAAGGTCGACGAGATAAACGAGGGTTTG
TCAAACCACGACCTTGGTATGAAGTAGAGTTGATTGTATCCAAAGACATC
ACTTCACAAGAAGGGTATCCGGTTCTGAAGTCTTTTACAGTTATTACCGA
TGATGGTTGGCAATTTCAATGCAAGACATCGGGGGATTACTCCAAAAACT
TCCGCTCAGAAAATGATTTAAAGACACTTGGTAAATGGATTAAAGGTCGT
TTGGAAAGTCATGGCTGCCTGCAAAATAACGAGAAGATTACGCATGAAAC
CCTACGCGAATACGGTAACGATCATTTTGAGTTACGTTCAACCGATAATC
CTGATGTTTGGCTGCTCTCATTTAAGGGGAAAAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy