Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0302 IGR0298 IGR0303 IGR0301 IGR0299 IGR0300 IGR0304 IGR0297 dcrG, - NG0364 dcmG, - NG0365 NG0363 NG0366 NG0358 hemD,gly1, - NG0359 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 dcrG, - NG0364 dcmG, - NG0365 NG0363 NG0366 NG0358 hemD,gly1, - NG0359 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 Type: tandem, Name:  - 17 dcrG, - NG0364 dcmG, - NG0365 NG0363 NG0366 hemD,gly1, - NG0359 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 NG0358
* Calculated from Protein Sequence

Gene ID: NG0362

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemE  

Definition:
uroporphyrinogen decarboxylase

Gene Start:
353265

Gene Stop:
354326

Gene Length:
1062

Molecular Weight*:
39004

pI*:
7.30

Net Charge*:
1.04

EC:
4.1.1.37  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Nishimura,K., Nakayashiki,T. and Inokuchi,H. 1993. Cloning and sequencing of the hemE gene encoding uroporphyrinogen III decarboxylase (UPD) from Escherichia coli K-12. Gene 133 (1): 109-113. Medline: 94040783.


Comment:
Oklahoma ID: NGO.362

For other 'hem' genes, see NG0234 and NG1580 (hemN), NG0293 (hemH), NG0360 (hemX), NG0040 (hemL), NG0385 (hemB), NG1318 (hemO), NG1403 (hemA), NG2015 (hemK). NG0359 may be hemD and NG0361 hemY.

Blast Summary:  PSI-Blast Search
NG0362 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative uroporphyrinogen decarboxylase protein: residues 1-354 are 97% similar to residues 1-354 of NG0362.

Numerous significant hits to uroporphyrinogen decarboxylase proteins in gapped BLAST; e.g. residues 1-353 are 68% similar to gb|AAG08419.1|AE004916_8 uroporphyrinogen decarboxylase of Pseudomonas aeruginosa, residues 1-352 are 66% similar to gb|AAC76971.1| uroporphyrinogen decarboxylase of Escherichia coli K12, residues 1-352 are 64% similar to gb|AAF93505.1| uroporphyrinogen decarboxylase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0407
COG name: Uroporphyrinogen-III decarboxylase
Functional Class:  H
The phylogenetic pattern of COG0407 is ----yq-cebr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000257 (Uroporphyrinogen decarboxylase (URO-D)) with a combined E-value of 1.1e-133.
    IPB000257A    22-36
    IPB000257B    53-97
    IPB000257C    139-161
    IPB000257D    167-221
    IPB000257E    242-256
    IPB000257F    262-293
    IPB000257G    320-330


ProDom Summary:  Protein Domain Search
Residues 9-345 are 65% similar to a (DECARBOXYLASE UROPORPHYRINOGEN) protein domain (PD003225) which is seen in DCUP_ECOLI.



Paralogs:  Local Blast Search


NG0362 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 347 (E-value = 1.6e-171) place NG0362 in the URO-D family which is described as Uroporphyrinogen decarboxylase (URO-D) (PF01208)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1URO|1URO-A UROPORPHYRINOGEN DECARBOXYLASE 306.0 5e-84
pdb|1JPH|1JPH-A ILE260THR MUTANT OF HUMAN UROD, HUMAN 305.0 1e-83
pdb|1JPI|1JPI-A PHE232LEU MUTANT OF HUMAN UROD, HUMAN 303.0 2e-83
pdb|1JPK|1JPK-A GLY1

Gene Protein Sequence:
MTLLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRTKAGSFLDLC
KNTGLATEVTIQPLERFDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFK
RALQHESDIAKLHVPDMEKLQYVFDAVTSIRKALDGRVPLIGFSGSPFTL
ACYMVEGGGSKEFRTIKTMMYSRPDLLYKILDTNAQAVTAYLNAQIDAGA
QAVQIFDTWGGVLSDAAFKEFSLKYIRQIVAGLKRESEGRRVPVIVFAKG
GGLWLESMAQIGADALGLDWTCNIGEARRRVGNQVALQGNFDPSALFGTP
ESIRTEVARILTGYGHGSGHVFNLGHGINQHADPEHAKILVDTVHELSRQ
YHGG

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCTTTTAAAAAACGATACCTTCCTCCGCGCCCTGCTCAAACAGCC
CGTCGAATACACACCGATTTGGATGATGCGCCAGGCGGGGCGTTATCTGC
CCGAATACAAAGCCACGCGCACGAAAGCGGGCAGCTTCCTCGATTTGTGC
AAAAACACCGGATTGGCGACCGAAGTCACCATCCAGCCTTTGGAACGCTT
CGATTTGGACGCGGCGATTTTGTTTTCCGACATCTTGACCGTTCCCGATG
CAATGGGCTTGGGGCTGTATTTTGCCGAAGGCGAAGGCCCGAAATTCAAA
CGCGCCTTGCAACACGAATCCGACATCGCCAAGCTGCACGTTCCCGACAT
GGAAAAACTGCAATACGTTTTCGACGCGGTAACTTCCATCCGTAAAGCAT
TGGACGGCCGCGTACCGCTTATCGGCTTCTCCGGCAGCCCGTTCACGCTC
GCCTGTTATATGGTCGAAGGCGGCGGCAGCAAAGAATTCCGCACCATCAA
AACCATGATGTACTCGCGCCCCGATTTGCTGTACAAAATCCTCGATACCA
ACGCCCAAGCCGTTACCGCCTACCTCAACGCCCAAATCGACGCGGGCGCG
CAGGCGGTGCAGATTTTCGACACTTGGGGCGGCGTGTTGAGCGACGCGGC
GTTTAAAGAGTTCAGCCTCAAATACATCCGCCAAATCGTTGCCGGACTCA
AACGTGAAAGCGAAGGTCGCCGCGTGCCTGTTATCGTGTTTGCCAAAGGC
GGCGGGCTGTGGCTGGAAAGCATGGCCCAAATCGGCGCAGACGCATTGGG
CTTGGACTGGACGTGCAACATCGGCGAAGCACGCCGCCGCGTCGGCAACC
AAGTCGCCCTGCAAGGCAACTTCGACCCGTCCGCCCTCTTCGGTACGCCC
GAATCCATCCGCACCGAGGTCGCACGTATCCTGACCGGCTACGGACACGG
CAGCGGCCATGTCTTCAACCTCGGACACGGCATCAACCAACACGCCGACC
CCGAACACGCCAAAATCTTAGTCGACACCGTACACGAGCTGTCGCGGCAG
TATCACGGCGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy