Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0296 IGR0302 IGR0298 IGR0295 IGR0301 IGR0299 IGR0300 IGR0294 IGR0297 dcrG, - NG0364 NG0363 NG0354 NG0358 tpn, - NG0355 hemD,gly1, - NG0359 NG0356 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 dcrG, - NG0364 NG0363 NG0354 NG0358 tpn, - NG0355 hemD,gly1, - NG0359 NG0356 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 dcrG, - NG0364 NG0363 NG0358 tpn, - NG0355 hemD,gly1, - NG0359 NG0356 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 NG0354
* Calculated from Protein Sequence

Gene ID: NG0360

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemX  

Definition:
probable uroporphyrin-III C-methyltransferase

Gene Start:
350702

Gene Stop:
351973

Gene Length:
1272

Molecular Weight*:
46116

pI*:
5.10

Net Charge*:
-7.52

EC:
2.1.1.107  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Sasarman,A., Echelard,Y., Letowski,J., Tardif,D. and Drolet,M. 1988. Nucleotide sequence of the hemX gene, the third member of the Uro operon of Escherichia coli K12. Nucleic Acids Res. 16 (24): 11835. Medline: 89098348.

Comment:
Oklahoma ID: NGO.360

For other 'hem' genes, see NG0234 and NG1580 (hemN), NG0293 (hemH), NG0040 (hemL), NG0362 (hemE), NG0385 (hemB), NG1318 (hemO), NG1403 (hemA), NG2015 (hemK). NG0359 may be hemD and NG0361 hemY.

Blast Summary:  PSI-Blast Search
NG0360 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a hypothetical protein: residues 1-424 are 95% similar to residues 1-424 of NG0360. NG0360 is orthologously related to AE002431, Neisseria meningitidis, strain MC58, a uroporphyrin-III C-methyltransferase (HemX) protein: residues 1-424 are 95% similar to residues 1-424 of NG0360.

A few significant hits to uroporphyrinogen III methylase (uroporphyrinogen III methylase) (HemX) in gapped BLAST; e.g. residues 4-383 are 23% similar to gb|AAC76806.1| uroporphyrinogen III methylase of Escherichia coli K12, residues 1-383 are 23% similar to 6960265 89% identity with E. coli putative uroporphyrinogen III methylase (HemX) of Salmonella typhimurium LT2, residues 28-334 are 26% similar to gb|AAF93296.1| uroporphyrin-III C-methyltransferase, putative of Vibrio cholerae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0360 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 398 (E-value = 2e-209) place NG0360 in the HemX family which is described as HemX (PF04375)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
113
transmembrane  
37  
53
non-globular  
312  
424

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPSETSSPRKENETEVHIPAAPFIVKQSGSNALAACALVLAALGLGASGF
LFVQGQNVLKNQELAFNQKIDKAALGESENAALLKDNLNRQSAIQSELDR
LDSGVKANGEQILMTQKAYRELTKGRADWLVDETETILNLAAQQLVLTGN
IQTAVGVLEHIDSRLSRFDQAELLPIKQAVSSDLAELKNRPYVDISGTAL
RLDRLETAVSGLPLILDGVLKPGVQARNEAVSASWWQNVWEKSLGTLKGL
VEIRRLENNDAMLISPEQAYFVRENLRLRLLDARTALMQRNGEVYQGDLN
NAEAAVRQYFDAKSPATQSWLKELAELKTLDVRMTADDGLKTSLNAVRAY
RDGTRMTAAENQEAEQAASEPANENTASEPAAASDVKAIEAPSLPSERKP
EQPAKKQPAPEKAGRSPSAKGERA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAACCTCTTCCCCACGCAAAGAAAACGAAACAGAAGTACA
CATTCCCGCCGCTCCTTTTATCGTCAAACAGTCCGGCAGCAACGCTTTGG
CGGCCTGCGCCTTGGTATTGGCGGCATTGGGTTTGGGTGCAAGTGGTTTT
TTGTTTGTCCAAGGACAGAATGTCTTGAAAAACCAAGAGCTGGCATTCAA
CCAGAAAATCGACAAAGCCGCCTTGGGCGAGTCGGAAAACGCCGCCCTGC
TCAAAGACAACCTCAACCGCCAAAGTGCCATACAGTCCGAACTCGACCGT
TTGGACAGCGGTGTCAAAGCCAACGGCGAACAAATCCTGATGACGCAAAA
AGCCTATCGCGAGCTGACCAAAGGGCGTGCCGATTGGCTGGTGGACGAAA
CCGAGACCATACTCAATCTGGCGGCGCAACAGCTGGTGTTGACCGGCAAT
ATCCAAACGGCAGTCGGCGTGTTGGAGCATATCGACAGCCGCCTGTCCCG
TTTCGATCAGGCAGAGCTTCTGCCGATCAAACAGGCGGTCAGCAGCGATT
TGGCGGAACTGAAAAACCGTCCCTATGTCGATATTTCCGGCACGGCATTG
CGCCTCGACCGGTTGGAAACCGCCGTATCCGGACTGCCGCTGATTTTGGA
CGGCGTATTGAAACCGGGCGTACAGGCCCGCAACGAAGCCGTTTCCGCTT
CATGGTGGCAGAACGTATGGGAAAAATCCCTCGGCACATTGAAGGGGCTG
GTCGAAATCCGCCGTTTGGAAAACAACGATGCCATGCTGATTTCTCCCGA
ACAGGCATATTTTGTGCGTGAAAACCTGCGTCTGCGCCTGTTGGATGCGC
GCACCGCATTGATGCAGCGCAACGGCGAAGTCTATCAGGGCGATTTGAAC
AATGCCGAAGCCGCCGTCAGACAGTATTTCGATGCCAAGTCGCCCGCCAC
GCAGTCGTGGCTGAAAGAACTGGCGGAATTGAAAACACTGGATGTACGCA
TGACGGCGGATGACGGCTTGAAGACCAGTTTAAATGCCGTCCGCGCCTAT
CGCGACGGTACGCGCATGACGGCGGCGGAAAATCAAGAAGCGGAACAGGC
GGCTTCCGAACCGGCAAACGAAAACACAGCTTCCGAACCGGCTGCCGCAT
CGGATGTGAAGGCCATAGAAGCACCGTCCCTGCCTTCGGAACGCAAACCG
GAACAGCCTGCAAAAAAACAGCCCGCACCGGAAAAGGCAGGGCGTTCGCC
GTCCGCTAAAGGAGAACGCGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy