Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0292 IGR0296 IGR0298 IGR0293 IGR0295 IGR0301 IGR0299 IGR0300 IGR0294 IGR0297 NG0363 NG0351 NG0354 NG0358 tpn, - NG0355 upp, - NG0353 hemD,gly1, - NG0359 NG0356 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 NG0363 NG0351 NG0354 NG0358 tpn, - NG0355 upp, - NG0353 hemD,gly1, - NG0359 NG0356 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 NG0363 NG0354 NG0358 tpn, - NG0355 upp, - NG0353 hemD,gly1, - NG0359 NG0356 NG0357 hemE, - NG0362 NG0361 hemX, - NG0360 NG0352 NG0351 NG0352
* Calculated from Protein Sequence

Gene ID: NG0359

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemD  gly1  

Definition:
gly1 (orf2) protein; uroporphyrinogen-III synthase

Gene Start:
349866

Gene Stop:
350627

Gene Length:
762

Molecular Weight*:
27986

pI*:
6.70

Net Charge*:
-0.88

EC:
4.2.1.7  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  
Cellular processes; Protein and peptide secretion  

Pathway: pathway table
Pentose and glucuronate interconversions

Primary Evidence:
Arvidson,C.G., Kirkpatrick,R., Witkamp,M.T., Larson,J.A.,
Schipper,C.A., Waldbeser,L.S., O'Gaora,P., Cooper,M. and So,M.
TITLE Neisseria gonorrhoeae mutants altered in toxicity to human
fallopian tubes and molecular characterization of the genetic locus
involved
JOURNAL Infect. Immun. 67 (2), 643-652 (1999)
MEDLINE: 99115537


Secondary Evidence:
Kafala B, Sasarman A.
Isolation of the Staphylococcus aureus hemCDBL gene cluster coding for early steps in heme biosynthesis.
Gene. 1997 Oct 15;199(1-2):231-9.
PMID: 9358061

Comment:
Oklahoma ID: NGO.359

Check start codon. Residue 8, a methionine, may be a more accurate start codon. No hits to the first 7 amino acid residues in gapped BLAST.

For other 'hem' genes, see NG0234 and NG1580 (hemN), NG0293 (hemH), NG0360 (hemX), NG0040 (hemL), NG0385 (hemB), NG1318
(hemO), NG1403 (hemA), NG2015 (hemK). NG0359 may be hemD and NG0361 hemY.

Reported to be regulated by pilA:

Arvidson,C.G., Stella,K.S., Waldbeser,L.S., O'Gaora,P. and So,M. Identification and characterization of gly1, a PilA-regulated locus of Neisseria gonorrhoeae. (gi|2580594).

Blast Summary:  PSI-Blast Search
NG0359 is similar to a previously sequenced N.gonorrhoeae protein in GenBank, 2580594, a predicted Gly1ORF2 protein: residues 1-247 are identical to residues 8-254 of NG0359.

NG0359 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a hypothetical protein: residues 1-246 are 90% similar to residues 8-253 of NG0359. NG0359 is orthologously related to AE002431, Neisseria meningitidis, strain MC58, a uroporphyrinogen-III synthase protein (HemD): residues 1-246 are 88% similar to residues 8-253 of NG0359.

Several weak hits to uroporphyrinogen-III synthase proteins in gapped BLAST; e.g. residues 8-194 are 25% similar to dbj|BAB38157.1| uroporphyrinogen III synthase of Escherichia coli O157:H7, residues 8-194 are 26% similar to gb|AAC76807.1| uroporphyrinogen III synthase of Escherichia coli K12, residues 85-221 are 31% similar to gb|AAG08644.1|AE004938_6 uroporphyrinogen-III synthetase of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 190-254 are identical to a (GLY1ORF2) protein domain (PD107301) which is seen in O30393_NEIGO.

Residues 9-189 are identical to a (UROPORPHYRINOGEN-III SYNTHASE UROS UROPORPHYRINOGEN- III) protein domain (PD016936) which is seen in O30393_NEIGO.



Paralogs:  Local Blast Search


NG0359 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
METAKPVMLIVRPSGRAKDDVEVCRRAGWQAEVLSPIEIETDEASLKRLP
EMYARADAVFWVSPAAVETAVPYLNLSDGIKAHIAVGQGSRRALARYAGA
GVFAPEDGNDSEAVLRLPVWNSLPEGARVLSVRGHGGRDFLMNALQEKGF
RTEVAEVYFRRHKPLNFQNFQTENIAAAYITSTELVQSLFAQLPPQFSRF
FKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSYSSISVSDGMVFPG
TSNQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAACAGCGAAGCCCGTCATGCTGATTGTCCGCCCGTCGGGCAGGGC
GAAGGACGATGTGGAAGTCTGCCGTCGTGCCGGATGGCAGGCGGAAGTGT
TGAGTCCGATTGAAATCGAAACCGACGAAGCAAGCCTGAAACGGCTGCCG
GAAATGTATGCCCGTGCGGATGCCGTGTTTTGGGTCAGTCCGGCCGCCGT
TGAAACCGCCGTCCCGTACCTTAACCTTTCAGACGGCATAAAGGCGCACA
TTGCCGTAGGGCAAGGCAGCCGCCGTGCCTTGGCGCGTTATGCGGGCGCG
GGCGTGTTTGCACCTGAAGACGGCAACGACAGCGAGGCGGTTTTGCGCCT
GCCGGTTTGGAACAGTCTGCCCGAAGGTGCGCGCGTATTGTCTGTGCGCG
GACACGGCGGGCGGGATTTTCTGATGAATGCCTTGCAGGAGAAAGGTTTT
CGGACGGAGGTGGCAGAAGTCTATTTCAGACGGCATAAACCTTTGAACTT
TCAAAATTTCCAAACCGAAAATATTGCCGCCGCCTATATTACGTCCACAG
AACTTGTGCAGTCGCTGTTTGCACAGCTTCCGCCGCAATTTTCCCGATTC
TTCAAATCCTTGCTATACTTTACCCATCATCCGCGCATTGCGGAGGCATT
GAAGCGCGAAGGCGTGTGTTCGGTCGAAACCGTCCCTACGCTGGAAGCCG
CGCTTTCCTATTCTTCCATTTCCGTTTCAGACGGCATGGTCTTTCCCGGA
ACCTCAAACCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy