Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0296 IGR0292 IGR0288 IGR0289 IGR0298 IGR0293 IGR0295 IGR0290 IGR0287 IGR0299 IGR0291 IGR0286 IGR0294 IGR0297 pfs, - NG0345 NG0350 NG0351 NG0354 pilZ, - NG0348 NG0358 tpn, - NG0355 upp, - NG0353 hemD,gly1, - NG0359 NG0349 NG0356 NG0357 holB, - NG0347 pilT, - NG0346 hemX, - NG0360 pfs, - NG0345 NG0350 NG0351 NG0354 pilZ, - NG0348 NG0358 tpn, - NG0355 upp, - NG0353 hemD,gly1, - NG0359 NG0349 NG0356 NG0357 holB, - NG0347 pilT, - NG0346 hemX, - NG0360 pfs, - NG0345 NG0354 pilZ, - NG0348 NG0358 tpn, - NG0355 upp, - NG0353 hemD,gly1, - NG0359 NG0349 NG0356 NG0357 holB, - NG0347 pilT, - NG0346 hemX, - NG0360 NG0352 NG0351 NG0350 NG0352
* Calculated from Protein Sequence

Gene ID: NG0353

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
upp  

Definition:
uracil phosphoribosyltransferase

Gene Start:
345543

Gene Stop:
346166

Gene Length:
624

Molecular Weight*:
22863

pI*:
5.40

Net Charge*:
-3.42

EC:
2.4.2.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Andersen,P.S., Smith,J.M. and Mygind,B. 1992. Characterization of the upp gene encoding uracil phosphoribosyltransferase of Escherichia coli K12. Eur. J. Biochem. 204 (1): 51-56. Medline: 92155236.


Comment:
For 'upp' genes see NG1797 (uppS)

Oklahoma ID: NGO.353

Blast Summary:  PSI-Blast Search
NG0353 is orthologously related to AE002431, Neisseria meningitidis, strain MC58, a uracil phosphoribosyltransferase protein: residues 1-208 are 98% similar to residues 1-208 of NG0353.

Numerous significant hits to uracil phosphoribosyltransferase (UMP pyrophosphorylase) in gapped BLAST; e.g. residues 1-208 are 65% similar to gb|AAF95369.1| uracil phosphoribosyltransferase of Vibrio cholerae, residues 1-208 are 64% similar to emb|CAA40388.1| uracil phosphoribosyltransferase of Escherichia coli, residues 1-208 are 63% similar to gb|AAC22881.1| uracil phosphoribosyltransferase of Haemophilus influenzae Rd.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0035
COG name: Uracil phosphoribosyltransferase
Functional Class:  F
The phylogenetic pattern of COG0035 is --t-Yqvcebrh--gp-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 174-207 are 76% similar to a (TRANSFERASE URACIL) protein domain (PD003612) which is seen in UPP_STRSL.

Residues 119-172 are 46% similar to a (URACIL PHOSPHORIBOSYLTRANSFERASE EC) protein domain (PD199979) which is seen in UPP_MYCTU.

Residues 6-115 are 61% similar to a (TRANSFERASE URACIL) protein domain (PD003137) which is seen in UPP_HAEIN.

Residues 127-169 are 74% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE) protein domain (PD000249) which is seen in UPP_HAEIN.

Residues 103-206 are 34% similar to a (URACIL PHOSPHORIBOSYLTRANSFERASE,) protein domain (PD183421) which is seen in O83462_TREPA.



Paralogs:  Local Blast Search


NG0353 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 48 to 179 (E-value = 2.8e-12) place NG0353 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1I5E|1I5E-A CRYSTAL STRUCTURE OF BACILLUS CALDOLYTICUS 239.0 4e-64
pdb|1BD3|1BD3-D STRUCTURE OF THE APO URACIL 101.0 2e-22
pdb|1UPF|1UPF-D STRUCTURE OF THE URACIL 101.0 2e-22
pdb|1I5E|1I5E-A CRYS

Gene Protein Sequence:
MNVNVINHPLVRHKLTLMREADCSTYKFRTLTTELARLMAYEASRDFEIE
KYLIDGWCGQIEGDRIKGKTLTVVPILRAGLGMLDGVLDLIPTAKISVVG
LQRDEETLKPISYFEKFVDSMDERPALIIDPMLATGGSMVATIDLLKEKG
CRNIKALVLVAAPEGVKAVNDAHPDVTIYTAALDSRLNENGYIIPGLGDA
GDKIFGTR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGTTAACGTTATCAACCATCCGCTCGTCCGCCACAAACTGACCCT
GATGAGGGAGGCGGATTGCAGCACCTACAAATTCCGTACGCTGACCACCG
AGTTGGCGCGCCTGATGGCATACGAGGCAAGCCGTGATTTTGAAATTGAA
AAATACCTTATCGACGGATGGTGCGGACAGATTGAAGGCGACCGCATCAA
AGGCAAAACCCTGACCGTCGTCCCCATCCTGCGCGCCGGTTTGGGTATGC
TCGACGGCGTGCTCGACCTGATTCCGACTGCCAAAATCAGCGTGGTCGGT
TTGCAGCGCGACGAGGAAACGCTGAAGCCTATTTCCTATTTTGAGAAATT
TGTGGACAGTATGGACGAGCGTCCGGCTTTGATTATCGATCCTATGCTGG
CGACAGGCGGTTCGATGGTGGCCACCATCGACCTGTTGAAAGAAAAAGGT
TGCCGCAACATCAAAGCCTTAGTCTTGGTTGCCGCCCCTGAGGGCGTGAA
GGCTGTTAATGATGCGCATCCCGATGTTACGATTTATACCGCCGCGCTGG
ATAGCCGTTTGAACGAAAACGGCTATATTATTCCCGGTCTGGGCGATGCG
GGCGACAAGATTTTCGGCACGCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy