Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0292 IGR0288 IGR0289 IGR0290 IGR0287 IGR0291 IGR0285 IGR0284 IGR0286 IGR0283 IGR0282.2 IGR0282.1 pfs, - NG0345 lepB, - NG0343 lepA, - NG0344 NG0350 NG0342 NG0351 pilZ, - NG0348 upp, - NG0353 NG0341 NG0349 holB, - NG0347 pilT, - NG0346 pfs, - NG0345 lepB, - NG0343 lepA, - NG0344 NG0350 NG0342 NG0351 pilZ, - NG0348 upp, - NG0353 NG0341 NG0349 holB, - NG0347 pilT, - NG0346 pfs, - NG0345 lepB, - NG0343 lepA, - NG0344 NG0342 pilZ, - NG0348 upp, - NG0353 NG0341 NG0349 holB, - NG0347 pilT, - NG0346 NG0352 NG0351 NG0350 NG0352
* Calculated from Protein Sequence

Gene ID: NG0345

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pfs  

Definition:
5-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase (MTA/SAH nucleosidase)

Gene Start:
341337

Gene Stop:
340639

Gene Length:
699

Molecular Weight*:
24792

pI*:
5.10

Net Charge*:
-6.87

EC:
3.2.2.16  3.2.2.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Arginine and proline metabolism
Methionine metabolism

Secondary Evidence:
Cornell,K.A. and Riscoe,M.K. 1998.
Cloning and expression of Escherichia coli 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase: identification of the pfs gene product.
Biochim. Biophys. Acta 1396 (1): 8-14.
Medline: 98193121.

Comment:
Oklahoma ID: NGO.345c

Blast Summary:  PSI-Blast Search
NG0345 is orthologously related to AE002431, Neisseria meningitidis, strain MC58, a 5-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase protein: residues 1-233 are 95% similar to residues 1-233 of NG0345.

Numerous significant hits in gapped BLAST; e.g. residues 6-233 are 51% similar to gb|AAF95522.1| MTA/SAH nucleosidase of Vibrio cholerae, residues 6-233 are 49% similar to 1172449 MTA/SAH nucleosidase (includes: 5-methylthioadenosine nucleosidase; S-adenosylhomocysteine nucleosidase) of Haemophilus influenzae, residues 6-233 are 47% similar to 10173895 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase of Bacillus halodurans.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0775
COG name: Nucleoside phosphorylase
Functional Class:  F
The phylogenetic pattern of COG0775 is ------vcEbRhuj--OliN-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000845 (Purine and other phosphorylases, family 1) with a combined E-value of 1.3e-11.
    IPB000845B    32-66
    IPB000845C    146-156
    IPB000845D    171-207


ProDom Summary:  Protein Domain Search
Residues 147-196 are 58% similar to a (PROTEIN PFS MTA/SAH NUCLEOSIDASE) protein domain (PD005987) which is seen in PFS_ECOLI.

Residues 6-135 are 46% similar to a (PROTEIN PFS MTA/SAH NUCLEOSIDASE) protein domain (PD004885) which is seen in PFS_BACSU.



Paralogs:  Local Blast Search


NG0345 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 230 (E-value = 3.2e-78) place NG0345 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
29
cleavable N-terminal sequence  
1  
58

PDB Hit:
pdb|1JYS|1JYS-A CRYSTAL STRUCTURE OF E. COLI MTA/ADOHCY 196.0 3e-51

Gene Protein Sequence:
MSLKTVAVIGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGKRIVLAL
SGIGKVNAAVATAWLIRQFAPDCVINTGSAGGLGKGLKVGDVVIGTETEH
HDVDVTAFGYARGQVPQLPARFASDGILIETAKRAARTFEGAEVEQGLIV
SGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVS
DSADEKADISFEEFLKTAAASSAKMVAEIVKSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTGAAAACAGTAGCCGTTATCGGCGCGATGGAACAGGAAATCGA
GCTTTTGCGCGAGATGATGGAAAATGTCAAAGCCGTCTCTTTCGGCAGAT
TTTCCGCCTATGAAGGCGAATTGGCGGGAAAACGCATAGTGCTTGCATTG
AGCGGCATCGGCAAGGTCAACGCGGCGGTTGCAACGGCTTGGCTTATCCG
TCAATTCGCACCGGACTGCGTCATCAACACCGGCAGCGCAGGCGGTTTGG
GCAAGGGTTTGAAAGTCGGCGACGTGGTGATCGGCACGGAAACCGAGCAC
CACGATGTCGATGTAACCGCATTCGGCTATGCCCGGGGGCAAGTGCCGCA
ACTGCCGGCAAGGTTCGCTTCAGACGGCATATTGATTGAAACGGCAAAAC
GGGCGGCGCGGACGTTTGAAGGCGCGGAGGTAGAACAAGGCCTGATTGTC
AGCGGCGACCGCTTCGTCCACAGCAGCGAAGGCGTGGCGGAAATCCGCAA
GCACTTCCCCGAAGTCAAAGCAGTGGAAATGGAAGCGGCGGCGATTGCCC
AAACCTGTCATCAGTTGGAAACGCCGTTCGTCATCATCCGCGCTGTTTCC
GATTCGGCGGACGAAAAGGCAGACATCAGCTTTGAAGAGTTTTTGAAAAC
GGCGGCGGCAAGTTCTGCAAAAATGGTGGCAGAAATCGTCAAATCTTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy