Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0287 IGR0281 IGR0285 IGR0284 IGR0282 IGR0286 IGR0283 IGR0282.2 IGR0282.1 pfs, - NG0345 lepB, - NG0343 lepA, - NG0344 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 holB, - NG0347 pilT, - NG0346 pfs, - NG0345 lepB, - NG0343 lepA, - NG0344 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 holB, - NG0347 pilT, - NG0346 pfs, - NG0345 lepB, - NG0343 lepA, - NG0344 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 holB, - NG0347 pilT, - NG0346
* Calculated from Protein Sequence

Gene ID: NG0343

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lepB  

Definition:
signal peptidase I (leader peptidase)

Gene Start:
338555

Gene Stop:
337539

Gene Length:
1017

Molecular Weight*:
37560

pI*:
6.20

Net Charge*:
-2.17

EC:
3.4.21.89  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Protein export

Secondary Evidence:
Smith,A.M., Yan,H., Groves,N., Dalla Pozza,T. and Walker,M.J. 2000.
Co-expression of the Bordetella pertussis leader peptidase I results in enhanced processing and expression of the pertussis toxin S1 subunit in Escherichia coli.
FEMS Microbiol. Lett. 191 (2): 177-182.
Medline: 20480667.

Wolfe,P.B., Wickner,W. and Goodman,J.M. 1983.
Sequence of the leader peptidase gene of Escherichia coli and the orientation of leader peptidase in the bacterial envelope.
J. Biol. Chem. 258 (19): 12073-12080.
Medline: 84008229.




Comment:
Oklahoma ID: NGO.343c

Blast Summary:  PSI-Blast Search
NG0343 is orthologously related to AE002430, Neisseria meningitidis, strain MC58, a signal peptidase I protein: residues 1-339 are 97% similar to residues 1-339 of NG0343.

Numerous significant hits to signal peptidase I (leader peptidase) in gapped BLAST; e.g. residues 94-335 are 47% similar to 5932443 leader peptidase of Bordetella pertussis, residues 98-328 are 42% similar to gb|AAC75621.1| leader peptidase (signal peptidase I) of Escherichia coli K12, residues 98-338 are 41% similar to gb|AAF95604.1| signal peptidase I of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0681
COG name: Signal peptidase I
Functional Class:  N
The phylogenetic pattern of COG0681 is AmTKYqvCeBrhuj--OLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000508 (Signal peptidase) with a combined E-value of 2.5e-42.
    IPB000508A    106-136
    IPB000508B    156-167
    IPB000508C    176-186
    IPB000508D    288-307


ProDom Summary:  Protein Domain Search
Residues 288-328 are 68% similar to a (PEPTIDASE SIGNAL I PROTEASE HYDROLASE TRANSMEMBRANE) protein domain (PD001438) which is seen in LEP_ECOLI.

Residues 95-236 are 32% similar to a (SIGNAL PEPTIDASE I SPASE) protein domain (PD109753) which is seen in LEP_HELPY.



Paralogs:  Local Blast Search


NG0343 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 80 to 319 (E-value = 9.6e-45) place NG0343 in the Peptidase_S26 family which is described as Signal peptidase I (PF00461)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
12
cleavable N-terminal sequence  
1  
59
transmembrane  
61  
77
transmembrane  
98  
114

PDB Hit:
pdb|1KN9|1KN9-A CRYSTAL STRUCTURE OF A BACTERIAL SIGNAL 159.0 6e-40
pdb|1B12|1B12-A CRYSTAL STRUCTURE OF TYPE 1 SIGNAL PEPTIDASE 159.0 1e-39
pdb|1KN9|1KN9-A CRYSTAL STRUCTURE OF A BACTERIAL SIGNAL 161.0 2e-40
pdb|1B12|1B12-A CRYS

Gene Protein Sequence:
MNTMLMSGAAAALLAGIILYFKSDKKRQENGEWSSGLEYAYILTAVGVFA
ALSLFMSFTAVFLIFVVLCGTAWGVYKYRLKTHPEISESSHFGDYFGSFF
PTVLVLFLIRSFIAEPFQIPSSSMRPGLIKGDFILVGKFSYGLRVPVLNN
VFIPTGKIERGDVVVFNYPLQPEMTYIKRIVGIPGDIVEYRDKVLTVNGK
PASDIPDGTYRYPDDTDPSEIHNTDMFRSGLDGKSFNILKKEGQPAVSLP
VLGKYTSDIMSENGYSIDQSGLNHCQYADDGSGFVCKVPEGRYFAMGDNR
DNSADSRYWGFVDDKLVVGKAMFILMNFGDFGRAGTAIR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACAATGCTAATGTCGGGCGCGGCTGCCGCGCTGCTTGCCGGCAT
CATCCTTTATTTCAAAAGCGACAAGAAACGGCAGGAAAACGGTGAATGGA
GTTCCGGCCTCGAATACGCCTATATCCTGACGGCGGTCGGTGTGTTTGCC
GCTTTGTCCCTGTTTATGAGCTTTACCGCCGTTTTCCTGATTTTCGTTGT
ATTGTGCGGTACGGCTTGGGGGGTATATAAATACCGCCTGAAGACTCATC
CCGAAATCTCGGAAAGCAGCCACTTCGGCGATTATTTCGGCAGTTTCTTC
CCTACCGTTTTGGTATTGTTCCTCATCCGGTCGTTTATTGCCGAACCGTT
CCAAATCCCGTCCAGCTCGATGCGCCCGGGATTAATCAAGGGCGATTTCA
TTTTGGTCGGCAAATTTTCCTACGGCCTGCGCGTACCCGTTTTAAACAAT
GTATTCATCCCCACGGGCAAAATCGAACGGGGCGATGTCGTTGTTTTTAA
CTATCCTTTGCAGCCGGAGATGACCTACATCAAGCGTATTGTCGGCATCC
CGGGCGACATTGTCGAATATCGAGATAAAGTTTTGACGGTAAACGGAAAA
CCGGCTTCCGACATTCCTGACGGCACATACCGTTATCCTGACGATACCGA
CCCATCCGAAATCCACAACACGGATATGTTCCGCAGCGGTCTGGACGGCA
AATCCTTCAATATTCTGAAAAAAGAAGGACAGCCTGCCGTTTCCCTGCCC
GTATTGGGCAAATATACCTCCGATATTATGTCTGAAAACGGATATTCCAT
AGATCAAAGCGGTCTGAACCATTGCCAATATGCCGACGACGGCAGCGGTT
TCGTGTGCAAAGTTCCCGAAGGACGCTATTTCGCTATGGGCGACAACCGC
GACAACAGTGCCGATTCGCGCTACTGGGGCTTTGTGGATGACAAGCTGGT
TGTCGGCAAGGCAATGTTCATTTTGATGAACTTCGGCGATTTCGGCAGGG
CCGGCACGGCAATCCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy