Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0280 IGR0281 IGR0284 IGR0282 IGR0283 IGR0282.2 IGR0282.1 NG0337 NG0336 lepB, - NG0343 lepA, - NG0344 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 pnp, - NG0335 NG0337 NG0336 lepB, - NG0343 lepA, - NG0344 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 pnp, - NG0335 NG0336 lepB, - NG0343 lepA, - NG0344 NG0337 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 pnp, - NG0335
* Calculated from Protein Sequence

Gene ID: NG0340

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cysK  

Definition:
cysteine synthase

Gene Start:
334712

Gene Stop:
335350

Gene Length:
639

Molecular Weight*:
22912

pI*:
8.10

Net Charge*:
1.39

EC:
4.2.99.8  

Functional Class:
Amino acid biosynthesis; Serine family  

Pathway: pathway table
Cysteine metabolism
Selenoamino acid metabolism
Sulfur metabolism

Secondary Evidence:
Burkhard P, Rao GS, Hohenester E, Schnackerz KD, Cook PF, Jansonius JN.
Three-dimensional structure of O-acetylserine sulfhydrylase from Salmonella typhimurium.
J Mol Biol. 1998;283(1):121-33.
PMID: 9761678

Levy,S. and Danchin,A.
Phylogeny of metabolic pathways: O-acetylserine sulphydrylase A is
homologous to the tryptophan synthase beta subunit
Mol. Microbiol. 2 (6), 777-783 (1988)
MEDLINE: 89096499

Byrne,C.R., Monroe,R.S., Ward,K.A. and Kredich,N.M.
DNA sequences of the cysK regions of Salmonella typhimurium and
Escherichia coli and linkage of the cysK regions to ptsH
J. Bacteriol. 170 (7), 3150-3157 (1988)
MEDLINE: 88257033


Comment:


Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to cysteine synthases, e.g. residues 17-213 are 64% similar to the cysK enzyme from Mycobacterium tuberculosis (Z83860). Residues 17-212 are 63% similar to the enzyme from M.leprae (Z98741).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0031
COG name: Cysteine synthase/cystathionine beta-synthase
Functional Class:  E
The phylogenetic pattern of COG0031 is ----YqvCEBRhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001216 (Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site) with a combined E-value of 1.6e-98.
    IPB001216A    27-36
    IPB001216B    46-90
    IPB001216C    95-144
    IPB001216D    157-197
***** IPB001926 (Pyridoxal-5'-phosphate-dependent enzymes, beta family) with a combined E-value of 4.7e-18.
    IPB001926A    83-110
    IPB001926B    164-172


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0340 is paralogously related to NG0444 (threonine dehydratase (threonine deaminase)) (1e-08).


Pfam Summary:  Pfam Search
Residues 23 to 213 (E-value = 4.3e-43) place NG0340 in the PALP family which is described as Pyridoxal-phosphate dependent enzyme (PF00291)

PDB Hit:
pdb|1FCJ|1FCJ-A CRYSTAL STRUCTURE OF OASS COMPLEXED WITH 138.0 6e-34
pdb|1D6S|1D6S-A CRYSTAL STRUCTURE OF THE K41A MUTANT OF 136.0 3e-33
pdb|1M54|1M54-A CYSTATHIONINE-BETA SYNTHASE: REDUCED VICINAL 119.0 4e-28
pdb|1JBQ|1JBQ-A STRU

Gene Protein Sequence:
MGIAPYCRNLIIQEQKMKIANSITELIGNTPLVKLNRLTKGLKAEVAVKL
EFFNPGSSVKDRIAEAMIEAAEKAGKINKNTVIVEATSGNTGIGLAMVCA
ARGYKLAITMPESMSKERKMLLRTFGAELILTPAAEGMAGAIAKAQSLVD
AHPDTYFMPRQFDNEANPEVHRKTTAEEIWNDTDGEVDVFVAGVGTGGTI
TGVGEVLKKYKPN

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGATTGCGCCTTACTGTCGAAACCTTATTATTCAGGAGCAGAAGAT
GAAAATTGCAAACAGCATCACCGAATTGATCGGCAACACGCCTTTGGTCA
AACTGAACCGTTTGACCAAAGGTTTGAAGGCAGAGGTTGCCGTGAAACTG
GAATTTTTTAATCCGGGCAGCAGCGTCAAAGACCGCATTGCCGAAGCAAT
GATCGAGGCCGCCGAAAAAGCGGGAAAAATCAACAAAAACACCGTCATTG
TCGAAGCAACCAGCGGCAATACGGGTATCGGTTTGGCAATGGTATGTGCC
GCACGCGGCTACAAACTGGCGATTACCATGCCGGAAAGCATGAGCAAAGA
GCGCAAAATGCTGTTGCGCACGTTTGGCGCGGAACTGATTCTAACCCCCG
CCGCCGAAGGTATGGCGGGCGCGATTGCCAAAGCGCAATCCTTGGTGGAC
GCTCATCCAGACACTTATTTTATGCCGCGCCAGTTCGACAATGAGGCAAA
TCCCGAAGTCCACCGCAAAACAACCGCCGAGGAAATTTGGAACGATACCG
ACGGTGAAGTCGATGTCTTCGTTGCCGGCGTCGGCACGGGCGGTACGATT
ACCGGCGTGGGCGAAGTGTTGAAAAAATACAAACCAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy