Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0280 IGR0278 IGR0281 IGR0282 IGR0283 IGR0279 IGR0282.2 IGR0282.1 NG0337 NG0336 lepB, - NG0343 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 purC, - NG0333 pnp, - NG0335 NG0337 NG0336 lepB, - NG0343 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 purC, - NG0333 pnp, - NG0335 NG0336 lepB, - NG0343 NG0337 NG0342 NG0339 cysK, - NG0340 NG0341 dapF, - NG0338 purC, - NG0333 pnp, - NG0335
* Calculated from Protein Sequence

Gene ID: NG0338

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dapF  

Definition:
diaminopimelate epimerase

Gene Start:
333111

Gene Stop:
333959

Gene Length:
849

Molecular Weight*:
30411

pI*:
4.60

Net Charge*:
-12.49

EC:
5.1.1.7  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Lysine biosynthesis

Secondary Evidence:
Richaud,C. and Printz,C. 1988.
Nucleotide sequence of the dapF gene and flanking regions from Escherichia coli K12.
Nucleic Acids Res. 16 (21): 10367.
Medline: 89057481.


Comment:
See also: dapA, NG0947; dapB, NG1781; dapD, NG1667; dapE, NG0991.

Oklahoma ID: NGO.338

Blast Summary:  PSI-Blast Search
NG0338 is orthologously related to AE002430, Neisseria meningitidis, strain MC58, a diaminopimelate epimerase protein: residues 1-283 are 97% similar to residues 1-283 of NG0338.

Numerous significant hits to diaminopimelate epimerase proteins in gapped BLAST; e.g. residues 4-278 are 54% similar to 13431432 diaminopimelate epimerase (DAP epimerase) of Pasteurella multocida, residues 4-278 are 56% similar to gb|AAG59002.1|AE005612_5 diaminopimelate epimerase of Escherichia coli O157:H7 EDL933, residues 6-281 are 54% similar to gb|AAF93303.1| diaminopimelate epimerase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0253
COG name: Diaminopimelate epimerase
Functional Class:  E
The phylogenetic pattern of COG0253 is amt--qvcebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001653 (Diaminopimelate epimerase) with a combined E-value of 1.8e-76.
    IPB001653A    6-18
    IPB001653B    39-49
    IPB001653C    66-82
    IPB001653D    115-126
    IPB001653E    160-182
    IPB001653F    192-202
    IPB001653G    219-230


ProDom Summary:  Protein Domain Search
Residues 4-280 are 51% similar to a (DIAMINOPIMELATE EPIMERASE DAP ISOMERASE LYSINE) protein domain (PD005029) which is seen in DAPF_PSEFL.



Paralogs:  Local Blast Search


NG0338 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 127 (E-value = 6.6e-41) place NG0338 in the DAP_epimerase family which is described as Diaminopimelate epimerase (PF01678)
Residues 158 to 275 (E-value = 3.5e-47) place NG0338 in the DAP_epimerase family which is described as Diaminopimelate epimerase (PF01678)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
167  
283
transmembrane  
225  
241

PDB Hit:
pdb|1BWZ|1BWZ-A DIAMINOPIMELATE EPIMERASE FROM HEMOPHILUS 252.0 6e-68

Gene Protein Sequence:
MKTLKFTKMHGLGNDFMVIDAVSQDFTPEDVPIAAWADRFRGVGFDQLLV
VGCSETEGVDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICV
ETAKGIIFPKLSDNGMVTVNMGKPKFMPSEIPFVPESGEGDDACIYGVHL
ESGIQPVSCVNMGNPHAVIVVDDVECAPVRETGSRIEPHRQFPERVNVGF
MQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGLLDEGKTVEVV
LPGGTLYIEWACGGDVMMTGPAETVFEGELAYS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACTTTGAAATTTACCAAAATGCACGGTTTGGGCAACGATTTTAT
GGTGATTGACGCGGTCAGTCAGGATTTTACCCCCGAGGACGTGCCGATTG
CGGCATGGGCGGACCGCTTCCGGGGCGTGGGCTTCGACCAGCTTTTGGTG
GTCGGGTGTTCGGAAACCGAAGGCGTGGATTTCCGTTACCGTATTTTCAA
TGCCGACGGTAGCGAGGTCGGGCAATGCGGCAACGGAGCGCGTTGTTTTG
CCCGTTTTGTTGCAGACAAGGGTTTGACCGATAAGAAAGAAATTTGTGTT
GAAACGGCCAAGGGCATTATTTTTCCGAAATTGTCCGATAACGGTATGGT
TACGGTCAATATGGGCAAACCGAAGTTTATGCCGTCTGAAATACCGTTTG
TCCCCGAATCGGGCGAGGGGGATGATGCCTGTATTTACGGGGTGCATCTC
GAATCCGGCATTCAGCCTGTCAGCTGCGTCAATATGGGCAATCCTCATGC
TGTGATTGTAGTCGATGACGTGGAATGCGCGCCGGTGCGCGAAACCGGTT
CGCGTATCGAACCGCACAGGCAGTTTCCCGAACGCGTCAACGTCGGCTTT
ATGCAGGTTGTCGGACGGACGGCAATCCGTTTGCGCGTGTTCGAGCGCGG
CGTGGGCGAAACCCAAGCGTGCGGTACGGGCGCGTGTGCGGCTGTGGTGG
CGGGTATCCGTCTGGGGCTGTTGGATGAAGGGAAAACGGTAGAGGTGGTT
TTGCCGGGCGGGACTTTATATATCGAATGGGCCTGCGGCGGCGATGTGAT
GATGACCGGCCCTGCGGAAACCGTGTTTGAAGGCGAGTTGGCGTATTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy