Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0280 IGR0276 IGR0278 IGR0275 IGR0281 IGR0282 IGR0279 IGR0277 IGR0282.1 NG0337 NG0330 NG0336 rmlD,rfbD, - NG0332 NG0331 NG0339 cysK, - NG0340 dapF, - NG0338 xerD, - NG0329 purC, - NG0333 pnp, - NG0335 NG0337 NG0330 NG0336 rmlD,rfbD, - NG0332 NG0331 NG0339 cysK, - NG0340 dapF, - NG0338 xerD, - NG0329 purC, - NG0333 pnp, - NG0335 NG0330 NG0336 rmlD,rfbD, - NG0332 NG0337 NG0331 NG0339 cysK, - NG0340 dapF, - NG0338 xerD, - NG0329 purC, - NG0333 pnp, - NG0335
* Calculated from Protein Sequence

Gene ID: NG0335

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pnp  

Definition:
polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)

Gene Start:
329799

Gene Stop:
331919

Gene Length:
2121

Molecular Weight*:
76448

pI*:
5.20

Net Charge*:
-15.35

EC:
2.7.7.8  

Functional Class:
Transcription; RNA synthesis, modification, and DNA transcription  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Regnier,P., Grunberg-Manago,M. and Portier,C. 1987. Nucleotide sequence of the pnp gene of Escherichia coli encoding
polynucleotide phosphorylase. Homology of the primary structure of
the protein with the RNA-binding domain of ribosomal protein S1. J. Biol. Chem. 262 (1): 63-68.
Medline: 87083499.

Jarrige A, Brechemier-Baey D, Mathy N, Duche O, Portier C. Mutational analysis of polynucleotide phosphorylase from Escherichia coli.
J Mol Biol. 2002 Aug 16;321(3):397-409.
PMID: 12162954

Evans,S. and Dennis,P.P. .
Promoter activity and transcript mapping in the regulatory region for genes encoding ribosomal protein S15 and polynucleotide phosphorylase of Escherichia coli.
Gene 40(1): 15-22.1985
Medline: 86137413.

Portier,C. and Regnier,P. .
Expression of the rpsO and pnp genes: structural analysis of a DNA fragment carrying their control regions.
Nucleic Acids Res. 12(15): 6091-6102.1984
Medline: 84297215.


Comment:
Oklahoma ID: NGO.335

Blast Summary:  PSI-Blast Search
NG0335 is orthologously related to AE002430, Neisseria meningitidis, strain MC58, a polyribonucleotide nucleotidyltransferase protein: residues 1-707 are 98% similar to residues 1-707 of NG0335.

Numerous significant hits to polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) in gapped BLAST; e.g. residues 2-703 are 63% similar to pir||S38883 polyribonucleotide nucleotidyltransferase of Xenorhabdus luminescens, residues 4-702 are 64% similar to gb|AAC21898.1| polynucleotide phosphorylase of Haemophilus influenzae Rd, residues 2-693 are 64% similar to gb|AAF93813.1| polyribonucleotide nucleotidyltransferase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1185
COG name: Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)
Functional Class:  J
The phylogenetic pattern of COG1185 is -----qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-129 are 71% similar to a (POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE) protein domain (PD005304) which is seen in PNP_HAEIN.

Residues 311-418 are 73% similar to a (NUCLEOTIDYLTRANSFERASE POLYRIBONUCLEOTIDE TRANSFERASE) protein domain (PD111902) which is seen in O87792_PSEPU.

Residues 417-543 are 43% similar to a (NUCLEOTIDYLTRANSFERASE TRANSFERASE POLYRIBONUCLEOTIDE) protein domain (PD002075) which is seen in P72659_SYNY3.

Residues 558-619 are 62% similar to a (PROTEIN BINDING REPEAT NUCLEAR RIBONUCLEOPROTEIN) protein domain (PD000456) which is seen in PNP_ECOLI.

Residues 621-693 are 61% similar to a (PROTEIN RIBOSOMAL S1 RNA-BINDING 30S REPEAT) protein domain (PD000709) which is seen in PNP_PHOLU.

Residues 131-308 are 55% similar to a (NUCLEOTIDYLTRANSFERASE POLYRIBONUCLEOTIDE) protein domain (PD005803) which is seen in PNP_HAEIN.



Paralogs:  Local Blast Search


NG0335 is paralogously related to NG1895 (conserved hypothetical protein) (3e-08), NG0604 (30S ribosomal protein S1) (2e-07) and NG0958 (ribonuclease PH; tRNA nucleotidyltransferase) (5e-05).


Pfam Summary:  Pfam Search
Residues 13 to 145 (E-value = 1.5e-36) place NG0335 in the RNase_PH family which is described as 3' exoribonuclease family, domain 1 (PF01138)
Residues 148 to 212 (E-value = 2.7e-15) place NG0335 in the RNase_PH_C family which is described as 3' exoribonuclease family, domain 2 (PF03725)
Residues 243 to 322 (E-value = 1.6e-34) place NG0335 in the PNPase family which is described as Polyribonucleotide nucleotidyltransferase, RNA binding domain (PF03726)
Residues 325 to 458 (E-value = 2.9e-49) place NG0335 in the RNase_PH family which is described as 3' exoribonuclease family, domain 1 (PF01138)
Residues 461 to 531 (E-value = 4.7e-19) place NG0335 in the RNase_PH_C family which is described as 3' exoribonuclease family, domain 2 (PF03725)
Residues 558 to 604 (E-value = 1.3e-10) place NG0335 in the KH family which is described as KH domain (PF00013)
Residues 619 to 693 (E-value = 1.2e-15) place NG0335 in the S1 family which is described as S1 RNA binding domain (PF00575)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
29  
45
non-globular  
95  
188
transmembrane  
131  
147
transmembrane  
443  
459
non-globular  
560  
644

PDB Hit:
pdb|1E3H|1E3H-A SEMET DERIVATIVE OF STREPTOMYCES ANTIBIOTICUS 542.0 0e+00
pdb|1SRO|1SRO S1 RNA BINDING DOMAIN, NMR, 20 STRUCTURES 91.7 4e-19
pdb|1E3H|1E3H-A SEMET DERIVATIVE OF STREPTOMYCES ANTIBIOTICUS 1081.0 0.000000
pdb|1SRO|1SRO S1

Gene Protein Sequence:
MMFNKYVKTFQYGNQTVTLETGEIARQAAAAVKVSMGDTVVFVAVTTNKE
VKEGQDFFPLAVDYLERTYAAGKIPGGFFKREGKQSEKEILTSRLIDRPI
RPLFPEGFYHDIQIVAMVVSVDPEIDSDIPAMLGASAALVLSGVPFAGPI
GAARVGYINGVYVLNPTKAELAKSQLDLVVAGTSKAVLMVESEAKILPED
VMLGAVVYGHDQMQVAINAINEFADEVNPEVWDWKAPETNEELVAKVRGI
AGETIKEAFKIRQKQARSAKLDEAWNAVKEALITEETDTLAANEIKGIFK
RLEADVVRSQILDGQPRIDGRDTRTVRPLNIQTGVLPRTHGSALFTRGET
QALAVATLGTSRDEQIIDALSGEYTDRFMLHYNFPPYSTGEVGRMGAPKR
REIGHGRLAKRALLAVLPKPEDFSYTMRVVSEITESNGSSSMASVCGGCL
SLLSAGVPLKAHVAGIAMGLILEGNKFAVLTDILGDEDHLGDMDFKVAGT
TEGVTALQMDIKIQGITKEIMQIALAQAKEARLHILDQMKAAVAGPQELS
AHAPRLFTMKISQDKIRDVIGKGGETIRSITAETGTEINIAEDGTITIAA
TTQEAGDAAKKRIEEITAEVEVGKVYEGTVVKILDNNVGAIVSVMPGKDG
LVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKALLDAPV
REENAAE

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGTTCAATAAATACGTTAAGACCTTCCAATACGGTAATCAAACCGT
TACTTTGGAAACCGGCGAAATTGCCCGCCAAGCTGCCGCTGCCGTTAAAG
TATCGATGGGCGACACTGTTGTTTTTGTTGCCGTTACCACCAACAAAGAG
GTCAAAGAAGGTCAGGACTTCTTCCCGTTGGCCGTCGATTATTTGGAACG
CACTTATGCCGCAGGCAAAATCCCCGGCGGCTTCTTCAAACGCGAAGGCA
AACAAAGCGAAAAAGAAATCCTGACCAGCCGTCTGATCGACCGCCCGATT
CGTCCGCTGTTCCCCGAAGGTTTCTACCACGACATCCAAATCGTAGCGAT
GGTTGTGTCCGTCGATCCCGAAATCGATTCCGACATTCCTGCAATGTTGG
GCGCGTCCGCCGCGCTGGTGTTGAGCGGCGTACCGTTCGCCGGCCCGATT
GGCGCGGCGCGCGTGGGTTATATAAACGGCGTGTACGTTTTGAACCCGAC
TAAAGCCGAGTTGGCGAAATCACAATTGGACTTGGTGGTCGCCGGTACTT
CCAAAGCCGTGTTGATGGTGGAATCCGAAGCCAAAATCCTGCCCGAAGAC
GTGATGTTGGGCGCGGTGGTTTACGGCCACGATCAAATGCAGGTTGCCAT
CAATGCAATCAATGAATTTGCCGACGAAGTGAATCCGGAAGTTTGGGATT
GGAAAGCACCTGAAACCAATGAAGAACTGGTTGCCAAAGTACGCGGGATT
GCCGGCGAAACCATTAAAGAAGCGTTCAAAATCCGTCAAAAACAAGCGCG
TTCCGCCAAATTGGACGAGGCTTGGAATGCGGTAAAAGAAGCCTTGATTA
CCGAAGAAACCGACACGCTGGCAGCCAACGAAATCAAAGGTATTTTCAAA
CGCTTGGAAGCCGATGTCGTCCGCAGCCAAATTTTGGACGGACAACCGCG
CATCGACGGCCGCGACACCCGCACCGTCCGTCCGCTGAACATCCAAACCG
GCGTATTGCCGCGCACGCACGGTTCCGCACTGTTTACCCGTGGCGAAACC
CAAGCCCTTGCCGTAGCGACTTTGGGTACTTCGCGCGACGAACAAATCAT
CGACGCGTTGTCCGGCGAATATACCGACCGCTTTATGCTGCACTACAACT
TTCCGCCGTACTCTACCGGCGAAGTGGGCCGCATGGGCGCGCCGAAACGC
CGTGAAATCGGTCACGGCCGTTTAGCTAAACGTGCGTTGTTGGCCGTATT
GCCGAAACCTGAAGATTTCAGCTACACCATGCGCGTGGTCTCCGAAATTA
CCGAATCCAACGGCTCTTCCTCTATGGCTTCTGTCTGCGGCGGCTGTTTG
AGCCTGCTGTCTGCCGGCGTGCCTTTGAAAGCACACGTTGCCGGTATCGC
GATGGGTCTGATTTTGGAAGGCAATAAGTTTGCCGTCCTGACCGACATTT
TGGGCGACGAAGACCACTTGGGCGATATGGACTTTAAAGTGGCCGGTACG
ACCGAAGGCGTTACCGCGCTGCAAATGGACATCAAAATCCAAGGCATTAC
CAAAGAGATTATGCAAATTGCTTTGGCACAGGCCAAAGAAGCGCGTTTGC
ACATCTTGGATCAGATGAAAGCTGCCGTTGCGGGTCCGCAAGAGCTGTCC
GCACACGCGCCGCGTTTGTTCACCATGAAAATCAGCCAAGACAAAATCCG
TGATGTGATTGGTAAAGGCGGCGAAACCATTCGTTCGATTACCGCTGAAA
CCGGTACTGAAATCAATATCGCTGAAGACGGTACCATCACTATCGCTGCG
ACTACTCAAGAAGCGGGCGATGCAGCGAAAAAACGCATCGAAGAAATCAC
TGCCGAAGTGGAAGTGGGCAAAGTGTACGAAGGTACTGTGGTTAAAATCC
TCGACAACAACGTCGGCGCGATTGTCAGCGTGATGCCGGGCAAAGACGGT
TTGGTACACATCAGCCAAATCGCACACGAGCGCGTACGCAATGTCGGCGA
TTACCTGCAAGTCGGTCAGGTGGTGAACGTGAAAGCATTGGAAGTGGATG
ACAGAGGCCGTGTCCGTCTGTCCATCAAAGCCCTGCTGGATGCGCCTGTC
CGTGAAGAAAATGCCGCCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy